Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1805784..1806615 | Replicon | chromosome |
| Accession | NZ_CP097881 | ||
| Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | NAG69_RS08610 | Protein ID | WP_000854814.1 |
| Coordinates | 1805784..1806158 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | P76364 |
| Locus tag | NAG69_RS08615 | Protein ID | WP_001285584.1 |
| Coordinates | 1806247..1806615 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NAG69_RS08570 (1801180) | 1801180..1802346 | + | 1167 | WP_000830156.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
| NAG69_RS08575 (1802465) | 1802465..1802938 | + | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
| NAG69_RS08580 (1803136) | 1803136..1804194 | + | 1059 | WP_001200891.1 | FUSC family protein | - |
| NAG69_RS08585 (1804366) | 1804366..1804695 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| NAG69_RS08590 (1804796) | 1804796..1804930 | - | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
| NAG69_RS08595 (1805050) | 1805050..1805178 | + | 129 | Protein_1678 | transposase domain-containing protein | - |
| NAG69_RS08600 (1805467) | 1805467..1805547 | - | 81 | Protein_1679 | hypothetical protein | - |
| NAG69_RS08605 (1805593) | 1805593..1805787 | - | 195 | WP_000988600.1 | DUF5983 family protein | - |
| NAG69_RS08610 (1805784) | 1805784..1806158 | - | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| NAG69_RS08615 (1806247) | 1806247..1806615 | - | 369 | WP_001285584.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| NAG69_RS08620 (1806689) | 1806689..1806910 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| NAG69_RS08625 (1806973) | 1806973..1807419 | - | 447 | WP_000187523.1 | RadC family protein | - |
| NAG69_RS08630 (1807416) | 1807416..1808948 | - | 1533 | WP_001350525.1 | protein YeeR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T246416 WP_000854814.1 NZ_CP097881:c1806158-1805784 [Escherichia coli str. K-12 substr. MG1655]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13651.52 Da Isoelectric Point: 5.9541
>AT246416 WP_001285584.1 NZ_CP097881:c1806615-1806247 [Escherichia coli str. K-12 substr. MG1655]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2H28 | |
| AlphaFold DB | A0A1M2E8G6 |