Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafN(antitoxin) |
| Location | 1425275..1425840 | Replicon | chromosome |
| Accession | NZ_CP097873 | ||
| Organism | Vibrio parahaemolyticus strain GL-601 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NAG75_RS07780 | Protein ID | WP_039485476.1 |
| Coordinates | 1425553..1425840 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | U3BLE1 |
| Locus tag | NAG75_RS07775 | Protein ID | WP_000086647.1 |
| Coordinates | 1425275..1425556 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NAG75_RS07715 | 1420571..1420660 | + | 90 | WP_077345982.1 | DUF3265 domain-containing protein | - |
| NAG75_RS07720 | 1420688..1421164 | + | 477 | WP_025510228.1 | GNAT family N-acetyltransferase | - |
| NAG75_RS07725 | 1421161..1421283 | + | 123 | WP_081008321.1 | DUF3265 domain-containing protein | - |
| NAG75_RS07730 | 1421321..1421611 | + | 291 | WP_025510227.1 | hypothetical protein | - |
| NAG75_RS07735 | 1421629..1421718 | + | 90 | Protein_1279 | DUF3265 domain-containing protein | - |
| NAG75_RS07740 | 1421752..1422228 | + | 477 | WP_264402606.1 | GNAT family N-acetyltransferase | - |
| NAG75_RS07745 | 1422246..1422335 | + | 90 | WP_077345960.1 | DUF3265 domain-containing protein | - |
| NAG75_RS07750 | 1422363..1422872 | + | 510 | WP_020838905.1 | ClbS/DfsB family four-helix bundle protein | - |
| NAG75_RS07755 | 1422887..1422979 | + | 93 | WP_074534461.1 | DUF3265 domain-containing protein | - |
| NAG75_RS07760 | 1423342..1423434 | + | 93 | WP_079858070.1 | DUF3265 domain-containing protein | - |
| NAG75_RS07765 | 1423520..1424272 | + | 753 | WP_264402607.1 | HNH endonuclease | - |
| NAG75_RS07770 | 1424351..1424443 | + | 93 | WP_006074995.1 | DUF3265 domain-containing protein | - |
| NAG75_RS07775 | 1425275..1425556 | + | 282 | WP_000086647.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NAG75_RS07780 | 1425553..1425840 | + | 288 | WP_039485476.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NAG75_RS07785 | 1426155..1426517 | + | 363 | WP_025510069.1 | hypothetical protein | - |
| NAG75_RS07790 | 1426688..1427143 | + | 456 | WP_158083940.1 | GNAT family N-acetyltransferase | - |
| NAG75_RS07795 | 1427158..1427250 | + | 93 | WP_079879156.1 | DUF3265 domain-containing protein | - |
| NAG75_RS07800 | 1427277..1427636 | + | 360 | WP_042765618.1 | hypothetical protein | - |
| NAG75_RS07805 | 1428162..1428287 | + | 126 | WP_079855902.1 | DUF3265 domain-containing protein | - |
| NAG75_RS07810 | 1428696..1428836 | + | 141 | WP_264402570.1 | DUF3265 domain-containing protein | - |
| NAG75_RS07815 | 1428929..1429285 | + | 357 | WP_083148402.1 | hypothetical protein | - |
| NAG75_RS07820 | 1429428..1429877 | + | 450 | WP_025543560.1 | hypothetical protein | - |
| NAG75_RS07825 | 1429919..1430008 | + | 90 | WP_079879063.1 | DUF3265 domain-containing protein | - |
| NAG75_RS07830 | 1430340..1430795 | - | 456 | WP_025509810.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | vpadF / vxsC / virG / exsA / exsD / vscB / vscC / vscD / vscF / vscG / vscH / vscI / vscJ / vscK / vscL / vopS / vopR / vecA / vopQ / vscU / vscT / vscS / vscR / vscQ / vscP / vscO / vscN / vopN / tyeA/vcr1 / sycN/vcr2 / vscX / vscY / vcrD / vcrR / vcrG / vcrV / vcrH / vopB / vopD / VP1611 | 1263975..1667722 | 403747 | |
| - | inside | Integron | - | - | 1339774..1448387 | 108613 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11011.68 Da Isoelectric Point: 5.1098
>T246406 WP_039485476.1 NZ_CP097873:1425553-1425840 [Vibrio parahaemolyticus]
MKVVWSPLALQKLGDAAEFISLDNPSAAEKWVNEVFDKTELLGSMPEMGRFVPEMPHTNYREIIFGHYRIIYSLSHEIRV
LTVRNCRQMLSEDDV
MKVVWSPLALQKLGDAAEFISLDNPSAAEKWVNEVFDKTELLGSMPEMGRFVPEMPHTNYREIIFGHYRIIYSLSHEIRV
LTVRNCRQMLSEDDV
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|