Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type II Classification (family/domain) relBE/YafN(antitoxin)
Location 1425275..1425840 Replicon chromosome
Accession NZ_CP097873
Organism Vibrio parahaemolyticus strain GL-601

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag NAG75_RS07780 Protein ID WP_039485476.1
Coordinates 1425553..1425840 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID U3BLE1
Locus tag NAG75_RS07775 Protein ID WP_000086647.1
Coordinates 1425275..1425556 (+) Length 94 a.a.

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NAG75_RS07715 1420571..1420660 + 90 WP_077345982.1 DUF3265 domain-containing protein -
NAG75_RS07720 1420688..1421164 + 477 WP_025510228.1 GNAT family N-acetyltransferase -
NAG75_RS07725 1421161..1421283 + 123 WP_081008321.1 DUF3265 domain-containing protein -
NAG75_RS07730 1421321..1421611 + 291 WP_025510227.1 hypothetical protein -
NAG75_RS07735 1421629..1421718 + 90 Protein_1279 DUF3265 domain-containing protein -
NAG75_RS07740 1421752..1422228 + 477 WP_264402606.1 GNAT family N-acetyltransferase -
NAG75_RS07745 1422246..1422335 + 90 WP_077345960.1 DUF3265 domain-containing protein -
NAG75_RS07750 1422363..1422872 + 510 WP_020838905.1 ClbS/DfsB family four-helix bundle protein -
NAG75_RS07755 1422887..1422979 + 93 WP_074534461.1 DUF3265 domain-containing protein -
NAG75_RS07760 1423342..1423434 + 93 WP_079858070.1 DUF3265 domain-containing protein -
NAG75_RS07765 1423520..1424272 + 753 WP_264402607.1 HNH endonuclease -
NAG75_RS07770 1424351..1424443 + 93 WP_006074995.1 DUF3265 domain-containing protein -
NAG75_RS07775 1425275..1425556 + 282 WP_000086647.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NAG75_RS07780 1425553..1425840 + 288 WP_039485476.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NAG75_RS07785 1426155..1426517 + 363 WP_025510069.1 hypothetical protein -
NAG75_RS07790 1426688..1427143 + 456 WP_158083940.1 GNAT family N-acetyltransferase -
NAG75_RS07795 1427158..1427250 + 93 WP_079879156.1 DUF3265 domain-containing protein -
NAG75_RS07800 1427277..1427636 + 360 WP_042765618.1 hypothetical protein -
NAG75_RS07805 1428162..1428287 + 126 WP_079855902.1 DUF3265 domain-containing protein -
NAG75_RS07810 1428696..1428836 + 141 WP_264402570.1 DUF3265 domain-containing protein -
NAG75_RS07815 1428929..1429285 + 357 WP_083148402.1 hypothetical protein -
NAG75_RS07820 1429428..1429877 + 450 WP_025543560.1 hypothetical protein -
NAG75_RS07825 1429919..1430008 + 90 WP_079879063.1 DUF3265 domain-containing protein -
NAG75_RS07830 1430340..1430795 - 456 WP_025509810.1 hypothetical protein -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - vpadF / vxsC / virG / exsA / exsD / vscB / vscC / vscD / vscF / vscG / vscH / vscI / vscJ / vscK / vscL / vopS / vopR / vecA / vopQ / vscU / vscT / vscS / vscR / vscQ / vscP / vscO / vscN / vopN / tyeA/vcr1 / sycN/vcr2 / vscX / vscY / vcrD / vcrR / vcrG / vcrV / vcrH / vopB / vopD / VP1611 1263975..1667722 403747
- inside Integron - - 1339774..1448387 108613


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.



Sequences


Toxin        


Download         Length: 96 a.a.        Molecular weight: 11011.68 Da        Isoelectric Point: 5.1098

>T246406 WP_039485476.1 NZ_CP097873:1425553-1425840 [Vibrio parahaemolyticus]
MKVVWSPLALQKLGDAAEFISLDNPSAAEKWVNEVFDKTELLGSMPEMGRFVPEMPHTNYREIIFGHYRIIYSLSHEIRV
LTVRNCRQMLSEDDV

Download         Length: 288 bp


Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10398.91 Da        Isoelectric Point: 5.8650

>AT246406 WP_000086647.1 NZ_CP097873:1425275-1425556 [Vibrio parahaemolyticus]
MSRIHFDQDIQPLSEFRAGVASYIKQINETRRPLVITQRGKGVAVVLDVAEYEAMQEKIELLEEMRTAEAQLASGLGVSN
DDARAQVLGRIKK

Download         Length: 282 bp


Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure


Antitoxin

Source ID Structure
AlphaFold DB A0A4P8G0X0

References