Detailed information of TA system TA246405

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): relBE/RelE-RelB
• Location: 1351294..1351853
• Replicon: chromosome
• Accession: NZ_CP097873
• Organism: Vibrio parahaemolyticus strain GL-601

Toxin (Protein)

• Gene name: relE
• Uniprot ID: A0A2I3C6F2
• Locus tag: NAG75_RS07150
• Protein ID: WP_005377065.1
• Coordinates: 1351294..1351572 (-)
• Length: 93 a.a.

Antitoxin (Protein)

• Gene name: relB
• Uniprot ID: -
• Locus tag: NAG75_RS07155
• Protein ID: WP_029852250.1
• Coordinates: 1351569..1351853 (-)
• Length: 95 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NAG75_RS07110	1346711..1346968	+	258	WP_140357558.1	hypothetical protein	-
NAG75_RS07115	1347201..1347329	+	129	WP_256875579.1	hypothetical protein	-
NAG75_RS07120	1347660..1348154	+	495	WP_264402567.1	hypothetical protein	-
NAG75_RS07125	1348297..1349043	+	747	WP_264402568.1	carbon-nitrogen hydrolase family protein	-
NAG75_RS07130	1349177..1349671	+	495	WP_264402569.1	GNAT family N-acetyltransferase	-
NAG75_RS07135	1349820..1350578	+	759	WP_020840807.1	hypothetical protein	-
NAG75_RS07140	1350723..1351148	+	426	WP_140329472.1	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	-
NAG75_RS07145	1351176..1351265	+	90	WP_140289191.1	DUF3265 domain-containing protein	-
NAG75_RS07150	1351294..1351572	-	279	WP_005377065.1	type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family	Toxin
NAG75_RS07155	1351569..1351853	-	285	WP_029852250.1	type II toxin-antitoxin system RelB/DinJ family antitoxin	Antitoxin
NAG75_RS07160	1352057..1352665	+	609	WP_021485172.1	pyridoxamine 5'-phosphate oxidase family protein	-
NAG75_RS07165	1353675..1353815	+	141	WP_264402570.1	DUF3265 domain-containing protein	-
NAG75_RS07170	1353842..1354492	+	651	WP_264402571.1	hypothetical protein	-
NAG75_RS07175	1354507..1354599	+	93	WP_264402572.1	DUF3265 domain-containing protein	-
NAG75_RS07180	1354626..1355156	+	531	WP_086495610.1	hypothetical protein	-
NAG75_RS07185	1355387..1355608	+	222	WP_029559552.1	hypothetical protein	-
NAG75_RS07190	1356366..1356644	+	279	WP_264402573.1	hypothetical protein	-
NAG75_RS07195	1356668..1356770	+	103	Protein_1171	DUF3265 domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Integrative and Conjugative Element	-	vpadF / vxsC / virG / exsA / exsD / vscB / vscC / vscD / vscF / vscG / vscH / vscI / vscJ / vscK / vscL / vopS / vopR / vecA / vopQ / vscU / vscT / vscS / vscR / vscQ / vscP / vscO / vscN / vopN / tyeA/vcr1 / sycN/vcr2 / vscX / vscY / vcrD / vcrR / vcrG / vcrV / vcrH / vopB / vopD / VP1611	1263975..1667722	403747
	-	inside	Integron	-	-	1339774..1448387	108613

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin-antitoxin system, RelE/ParE toxin family (2-89)

Antitoxin

• RelB antitoxin/Antitoxin DinJ (5-69)

Sequences

Toxin

Protein

• Length: 93 a.a.
• Molecular weight: 10905.60 Da
• Isoelectric Point: 4.3430

>T246405 WP_005377065.1 NZ_CP097873:c1351572-1351294 [Vibrio parahaemolyticus]
MILWEEESLNDREKIFEFLYDFNPDAAEKTDNLIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIISYWVEGDIIRVM
RVLHQKQKFPTD

Nucleotide

• Length: 279 bp

Antitoxin

Protein

• Length: 95 a.a.
• Molecular weight: 11068.46 Da
• Isoelectric Point: 10.3074

>AT246405 WP_029852250.1 NZ_CP097873:c1351853-1351569 [Vibrio parahaemolyticus]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKTLSHDAWLTEQVNLAFEKFDSGKSVFVKHQTAKSR
MEERKARIRNRGKQ

Nucleotide

• Length: 285 bp

Structures

Toxin

• AlphaFold DB: A0A2I3C6F2