Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-Phd |
| Location | 3614058..3614701 | Replicon | chromosome |
| Accession | NZ_CP097870 | ||
| Organism | Thauera sp. GDN1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | CKCBHOJB_RS16630 | Protein ID | WP_270068596.1 |
| Coordinates | 3614288..3614701 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | CKCBHOJB_RS16625 | Protein ID | WP_281049779.1 |
| Coordinates | 3614058..3614291 (+) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CKCBHOJB_RS16605 (CKCBHOJB_03319) | 3609243..3610475 | + | 1233 | WP_281049775.1 | acetamidase/formamidase family protein | - |
| CKCBHOJB_RS16610 (CKCBHOJB_03320) | 3610556..3610900 | + | 345 | WP_281049776.1 | zinc ribbon domain-containing protein | - |
| CKCBHOJB_RS16615 (CKCBHOJB_03321) | 3611323..3612933 | - | 1611 | WP_281049777.1 | hypothetical protein | - |
| CKCBHOJB_RS16620 (CKCBHOJB_03322) | 3612936..3613595 | - | 660 | WP_281049778.1 | hypothetical protein | - |
| CKCBHOJB_RS16625 (CKCBHOJB_03323) | 3614058..3614291 | + | 234 | WP_281049779.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| CKCBHOJB_RS16630 (CKCBHOJB_03324) | 3614288..3614701 | + | 414 | WP_270068596.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| CKCBHOJB_RS16635 (CKCBHOJB_03325) | 3614831..3615868 | + | 1038 | WP_281049780.1 | aliphatic amidase | - |
| CKCBHOJB_RS16640 (CKCBHOJB_03326) | 3615925..3616896 | + | 972 | WP_281049781.1 | D-glycerate dehydrogenase | - |
| CKCBHOJB_RS16645 (CKCBHOJB_03327) | 3616897..3617919 | - | 1023 | WP_281049782.1 | UDP-N-acetylmuramate dehydrogenase | - |
| CKCBHOJB_RS16650 (CKCBHOJB_03328) | 3617921..3618412 | - | 492 | WP_281049783.1 | PACE efflux transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | gmd / fcl | 3483069..3707240 | 224171 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15106.32 Da Isoelectric Point: 5.1663
>T246400 WP_270068596.1 NZ_CP097870:3614288-3614701 [Thauera sp. GDN1]
MSYLIDTNVLSELRRKSPDPGVVAWFSQRPPTTLHLSVLTLGEIRKGIEGVGDEVRKQTLIDWLETDLPTFFTGRILDVN
GAVADRWGRLVAAAGRPLPTIDSLLAATALEHDLVLVTRNTKDFAGLPVEVFNPWTS
MSYLIDTNVLSELRRKSPDPGVVAWFSQRPPTTLHLSVLTLGEIRKGIEGVGDEVRKQTLIDWLETDLPTFFTGRILDVN
GAVADRWGRLVAAAGRPLPTIDSLLAATALEHDLVLVTRNTKDFAGLPVEVFNPWTS
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|