Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2799923..2800530 | Replicon | chromosome |
| Accession | NZ_CP097870 | ||
| Organism | Thauera sp. GDN1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | CKCBHOJB_RS12825 | Protein ID | WP_281049060.1 |
| Coordinates | 2799923..2800081 (+) | Length | 53 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | CKCBHOJB_RS12830 | Protein ID | WP_281049061.1 |
| Coordinates | 2800120..2800530 (+) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CKCBHOJB_RS12795 (CKCBHOJB_02548) | 2796467..2796916 | - | 450 | WP_281049054.1 | MaoC family dehydratase | - |
| CKCBHOJB_RS12800 (CKCBHOJB_02549) | 2797160..2797534 | - | 375 | WP_281049055.1 | hypothetical protein | - |
| CKCBHOJB_RS12805 (CKCBHOJB_02550) | 2797638..2798057 | - | 420 | WP_281049056.1 | VOC family protein | - |
| CKCBHOJB_RS12810 (CKCBHOJB_02551) | 2798155..2799093 | - | 939 | WP_281049057.1 | AEC family transporter | - |
| CKCBHOJB_RS12815 (CKCBHOJB_02552) | 2799239..2799493 | + | 255 | WP_281049058.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| CKCBHOJB_RS12820 (CKCBHOJB_02553) | 2799493..2799693 | + | 201 | WP_281049059.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| CKCBHOJB_RS12825 | 2799923..2800081 | + | 159 | WP_281049060.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| CKCBHOJB_RS12830 (CKCBHOJB_02554) | 2800120..2800530 | + | 411 | WP_281049061.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| CKCBHOJB_RS12835 (CKCBHOJB_02555) | 2800652..2801041 | + | 390 | WP_281049062.1 | hypothetical protein | - |
| CKCBHOJB_RS12840 (CKCBHOJB_02556) | 2801260..2804178 | + | 2919 | WP_281049063.1 | monovalent cation/H+ antiporter subunit A | - |
| CKCBHOJB_RS12845 (CKCBHOJB_02557) | 2804169..2804510 | + | 342 | WP_281049064.1 | Na+/H+ antiporter subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 5726.60 Da Isoelectric Point: 10.4729
>T246399 WP_281049060.1 NZ_CP097870:2799923-2800081 [Thauera sp. GDN1]
MIQEDGWYLVAVKGSHHQFKHPNKAGRVTIPHPRTGLPPGTLNSILKQAGLE
MIQEDGWYLVAVKGSHHQFKHPNKAGRVTIPHPRTGLPPGTLNSILKQAGLE
Download Length: 159 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 14710.60 Da Isoelectric Point: 4.5036
>AT246399 WP_281049061.1 NZ_CP097870:2800120-2800530 [Thauera sp. GDN1]
MLYPIAIEPGDDVHAFGVVVPDIPGCFSAGDTLDEAIANAREAIELHLEGVAEDGADIPVAGTVAQHQAKSEFAGWIWAV
VDIDVTRYMGKAEKINITLPASLIRRIDDFVARHPEYRSRSGFLAQSALDRITHSA
MLYPIAIEPGDDVHAFGVVVPDIPGCFSAGDTLDEAIANAREAIELHLEGVAEDGADIPVAGTVAQHQAKSEFAGWIWAV
VDIDVTRYMGKAEKINITLPASLIRRIDDFVARHPEYRSRSGFLAQSALDRITHSA
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|