Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1342018..1342808 | Replicon | chromosome |
Accession | NZ_CP097870 | ||
Organism | Thauera sp. GDN1 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | CKCBHOJB_RS06055 | Protein ID | WP_281051107.1 |
Coordinates | 1342308..1342808 (+) | Length | 167 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | - |
Locus tag | CKCBHOJB_RS06050 | Protein ID | WP_281051106.1 |
Coordinates | 1342018..1342311 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKCBHOJB_RS06025 (CKCBHOJB_01207) | 1337313..1338188 | + | 876 | WP_281051102.1 | bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD | - |
CKCBHOJB_RS06030 (CKCBHOJB_01208) | 1338199..1338690 | + | 492 | WP_281051103.1 | 5-(carboxyamino)imidazole ribonucleotide mutase | - |
CKCBHOJB_RS06035 (CKCBHOJB_01209) | 1338701..1339855 | + | 1155 | WP_281051104.1 | 5-(carboxyamino)imidazole ribonucleotide synthase | - |
CKCBHOJB_RS06040 (CKCBHOJB_01210) | 1339866..1340978 | + | 1113 | WP_281051105.1 | L-threonylcarbamoyladenylate synthase | - |
CKCBHOJB_RS06050 (CKCBHOJB_01212) | 1342018..1342311 | + | 294 | WP_281051106.1 | DUF1778 domain-containing protein | Antitoxin |
CKCBHOJB_RS06055 (CKCBHOJB_01213) | 1342308..1342808 | + | 501 | WP_281051107.1 | GNAT family N-acetyltransferase | Toxin |
CKCBHOJB_RS06060 (CKCBHOJB_01214) | 1342873..1343790 | - | 918 | WP_281051108.1 | helix-turn-helix domain-containing protein | - |
CKCBHOJB_RS06065 (CKCBHOJB_01215) | 1343922..1344374 | - | 453 | WP_281051109.1 | site-specific recombinase resolvase | - |
CKCBHOJB_RS06070 | 1344401..1344760 | - | 360 | WP_281051110.1 | hypothetical protein | - |
CKCBHOJB_RS06075 | 1344750..1345106 | + | 357 | Protein_1189 | transposase | - |
CKCBHOJB_RS06080 | 1345089..1345430 | + | 342 | WP_281051632.1 | CoA transferase | - |
CKCBHOJB_RS06085 (CKCBHOJB_01218) | 1345488..1345661 | + | 174 | WP_281051111.1 | hypothetical protein | - |
CKCBHOJB_RS06090 (CKCBHOJB_01219) | 1345859..1346146 | + | 288 | WP_281051112.1 | hypothetical protein | - |
CKCBHOJB_RS06095 (CKCBHOJB_01220) | 1346523..1347743 | + | 1221 | WP_281051113.1 | RNA polymerase sigma factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 167 a.a. Molecular weight: 18353.33 Da Isoelectric Point: 9.6009
>T246397 WP_281051107.1 NZ_CP097870:1342308-1342808 [Thauera sp. GDN1]
MSLRGPESLGLQHRLEGFDCGKPALNDWLLCHARQAQGSGSAKTFVVADDDRVAGYFSLTVGQIDTLEAPERIRKGMGQY
PLPVVILARLAVSKQDRGRGIGFGLLQDAIRRTMLIAEQAGIRAMLTHPIDEEAAKFYTRFGFIASPLREQQLLLLLKDA
RKFVMA
MSLRGPESLGLQHRLEGFDCGKPALNDWLLCHARQAQGSGSAKTFVVADDDRVAGYFSLTVGQIDTLEAPERIRKGMGQY
PLPVVILARLAVSKQDRGRGIGFGLLQDAIRRTMLIAEQAGIRAMLTHPIDEEAAKFYTRFGFIASPLREQQLLLLLKDA
RKFVMA
Download Length: 501 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|