Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 3027448..3028211 | Replicon | chromosome |
Accession | NZ_CP097858 | ||
Organism | Vibrio owensii strain GL-605 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | A0A919BFZ0 |
Locus tag | M8C01_RS13915 | Protein ID | WP_023584043.1 |
Coordinates | 3027705..3028211 (+) | Length | 169 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | - |
Locus tag | M8C01_RS13910 | Protein ID | WP_000212004.1 |
Coordinates | 3027448..3027714 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8C01_RS13900 | 3022797..3023906 | - | 1110 | WP_122067050.1 | hypothetical protein | - |
M8C01_RS13905 | 3023903..3026632 | - | 2730 | WP_122067049.1 | DEAD/DEAH box helicase | - |
M8C01_RS13910 | 3027448..3027714 | + | 267 | WP_000212004.1 | DUF1778 domain-containing protein | Antitoxin |
M8C01_RS13915 | 3027705..3028211 | + | 507 | WP_023584043.1 | GNAT family N-acetyltransferase | Toxin |
M8C01_RS13920 | 3028252..3028638 | - | 387 | WP_023584042.1 | TraA family conjugative transfer protein | - |
M8C01_RS13925 | 3028635..3029207 | - | 573 | WP_001944091.1 | type IV conjugative transfer system lipoprotein TraV | - |
M8C01_RS13930 | 3029282..3030571 | - | 1290 | WP_086597841.1 | TraB/VirB10 family protein | - |
M8C01_RS13935 | 3030574..3031470 | - | 897 | WP_086597854.1 | type-F conjugative transfer system secretin TraK | - |
M8C01_RS13940 | 3031454..3032080 | - | 627 | WP_000667170.1 | TraE/TraK family type IV conjugative transfer system protein | - |
M8C01_RS13945 | 3032077..3032358 | - | 282 | WP_000433889.1 | type IV conjugative transfer system protein TraL | - |
M8C01_RS13950 | 3032539..3032862 | + | 324 | WP_054103799.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
M8C01_RS13955 | 3032859..3033137 | + | 279 | WP_054103798.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | sul2 / aph(3'')-Ib / aph(6)-Id / tet(59) | - | 3002833..3073041 | 70208 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 169 a.a. Molecular weight: 18278.00 Da Isoelectric Point: 7.2132
>T246392 WP_023584043.1 NZ_CP097858:3027705-3028211 [Vibrio owensii]
MGISAPTLLTDEHQLNAFQCGIEELDTWLRKQALKSQKRGTARVYVVNDTDAHQVVGYYAIAMGSVSREQAFSSLRRNSP
DPIPMVILARLGVDNAYQGQGIAAGLLKDCIIRSVQAMNAVGGAGILVHAIDGSAQTFYKKFGFKESTFDPLVLMARICD
IEKSLSID
MGISAPTLLTDEHQLNAFQCGIEELDTWLRKQALKSQKRGTARVYVVNDTDAHQVVGYYAIAMGSVSREQAFSSLRRNSP
DPIPMVILARLGVDNAYQGQGIAAGLLKDCIIRSVQAMNAVGGAGILVHAIDGSAQTFYKKFGFKESTFDPLVLMARICD
IEKSLSID
Download Length: 507 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|