Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 5548512..5549017 | Replicon | chromosome |
| Accession | NZ_CP097857 | ||
| Organism | Pseudomonas sp. B111 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | V6A7K8 |
| Locus tag | M6E97_RS25685 | Protein ID | WP_003083773.1 |
| Coordinates | 5548512..5548793 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A1C7BDS9 |
| Locus tag | M6E97_RS25690 | Protein ID | WP_003083775.1 |
| Coordinates | 5548790..5549017 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M6E97_RS25660 (M6E97_25620) | 5543763..5545112 | + | 1350 | WP_003119513.1 | C4-dicarboxylate transporter DctA | - |
| M6E97_RS25665 (M6E97_25625) | 5545161..5545847 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
| M6E97_RS25670 (M6E97_25630) | 5545948..5546682 | + | 735 | WP_003110658.1 | GntR family transcriptional regulator | - |
| M6E97_RS25675 (M6E97_25635) | 5546862..5547272 | + | 411 | WP_003110659.1 | aegerolysin family protein | - |
| M6E97_RS25680 (M6E97_25640) | 5547304..5548212 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
| M6E97_RS25685 (M6E97_25645) | 5548512..5548793 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| M6E97_RS25690 (M6E97_25650) | 5548790..5549017 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| M6E97_RS25695 (M6E97_25655) | 5549193..5549813 | - | 621 | WP_003101226.1 | hypothetical protein | - |
| M6E97_RS25700 (M6E97_25660) | 5549914..5550414 | + | 501 | WP_003162763.1 | LEA type 2 family protein | - |
| M6E97_RS25705 (M6E97_25665) | 5550487..5550828 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
| M6E97_RS25710 (M6E97_25670) | 5550910..5552337 | - | 1428 | WP_003083784.1 | GABA permease | - |
| M6E97_RS25715 (M6E97_25675) | 5552506..5553999 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T246390 WP_003083773.1 NZ_CP097857:c5548793-5548512 [Pseudomonas sp. B111]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|