Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/- |
Location | 2917724..2918945 | Replicon | chromosome |
Accession | NZ_CP097857 | ||
Organism | Pseudomonas sp. B111 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A0H2Z8V4 |
Locus tag | M6E97_RS13475 | Protein ID | WP_003110488.1 |
Coordinates | 2918367..2918945 (+) | Length | 193 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | M6E97_RS13470 | Protein ID | WP_003117666.1 |
Coordinates | 2917724..2918278 (+) | Length | 185 a.a. |
Genomic Context
Location: 2913296..2913847 (552 bp)
Type: Others
Protein ID: WP_003132721.1
Type: Others
Protein ID: WP_003132721.1
Location: 2914909..2915370 (462 bp)
Type: Others
Protein ID: WP_003102736.1
Type: Others
Protein ID: WP_003102736.1
Location: 2915375..2917570 (2196 bp)
Type: Others
Protein ID: WP_023875495.1
Type: Others
Protein ID: WP_023875495.1
Location: 2917724..2918278 (555 bp)
Type: Antitoxin
Protein ID: WP_003117666.1
Type: Antitoxin
Protein ID: WP_003117666.1
Location: 2918367..2918945 (579 bp)
Type: Toxin
Protein ID: WP_003110488.1
Type: Toxin
Protein ID: WP_003110488.1
Location: 2913844..2914242 (399 bp)
Type: Others
Protein ID: WP_033990114.1
Type: Others
Protein ID: WP_033990114.1
Location: 2914255..2914578 (324 bp)
Type: Others
Protein ID: WP_003102734.1
Type: Others
Protein ID: WP_003102734.1
Location: 2919055..2920242 (1188 bp)
Type: Others
Protein ID: WP_003139884.1
Type: Others
Protein ID: WP_003139884.1
Location: 2920232..2922403 (2172 bp)
Type: Others
Protein ID: WP_003088105.1
Type: Others
Protein ID: WP_003088105.1
Location: 2922393..2923670 (1278 bp)
Type: Others
Protein ID: WP_003088104.1
Type: Others
Protein ID: WP_003088104.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M6E97_RS13445 (M6E97_13425) | 2913296..2913847 | + | 552 | WP_003132721.1 | XRE family transcriptional regulator | - |
M6E97_RS13450 (M6E97_13430) | 2913844..2914242 | - | 399 | WP_033990114.1 | NADH-quinone oxidoreductase subunit A | - |
M6E97_RS13455 (M6E97_13435) | 2914255..2914578 | - | 324 | WP_003102734.1 | multidrug efflux SMR transporter | - |
M6E97_RS13460 (M6E97_13440) | 2914909..2915370 | + | 462 | WP_003102736.1 | (2Fe-2S)-binding protein | - |
M6E97_RS13465 (M6E97_13445) | 2915375..2917570 | + | 2196 | WP_023875495.1 | xanthine dehydrogenase family protein molybdopterin-binding subunit | - |
M6E97_RS13470 (M6E97_13450) | 2917724..2918278 | + | 555 | WP_003117666.1 | helix-turn-helix transcriptional regulator | Antitoxin |
M6E97_RS13475 (M6E97_13455) | 2918367..2918945 | + | 579 | WP_003110488.1 | HD domain-containing protein | Toxin |
M6E97_RS13480 (M6E97_13460) | 2919055..2920242 | - | 1188 | WP_003139884.1 | HlyD family efflux transporter periplasmic adaptor subunit | - |
M6E97_RS13485 (M6E97_13465) | 2920232..2922403 | - | 2172 | WP_003088105.1 | type I secretion system permease/ATPase | - |
M6E97_RS13490 (M6E97_13470) | 2922393..2923670 | - | 1278 | WP_003088104.1 | TolC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 193 a.a. Molecular weight: 21913.75 Da Isoelectric Point: 5.3655
>T246388 WP_003110488.1 NZ_CP097857:2918367-2918945 [Pseudomonas sp. B111]
MSLELLSNRLEFLREAERLKDVLRSAHTSSGRPESTAEHSWRLCLMALAFEDQLAGLDLGKVLRMCVVHDLGEAIHGDIP
AVEQAAHPDKGEQERADLLQLTRHLDTPLRDRLLALWDEYERGETAEALAVKALDKLETLLQHTQGDNPADFDYAFNLDY
GRRYTDRAPLFKTLRELLDARTRQRLAARRDA
MSLELLSNRLEFLREAERLKDVLRSAHTSSGRPESTAEHSWRLCLMALAFEDQLAGLDLGKVLRMCVVHDLGEAIHGDIP
AVEQAAHPDKGEQERADLLQLTRHLDTPLRDRLLALWDEYERGETAEALAVKALDKLETLLQHTQGDNPADFDYAFNLDY
GRRYTDRAPLFKTLRELLDARTRQRLAARRDA
Download Length: 579 bp
Antitoxin
Download Length: 185 a.a. Molecular weight: 20454.67 Da Isoelectric Point: 8.5356
>AT246388 WP_003117666.1 NZ_CP097857:2917724-2918278 [Pseudomonas sp. B111]
MTEPLPSSSLGPALRRWRLLHRVKQTHAAELLGVAQSTISRWESGTQALLVEERARLERLLGARLEAAADKALARLVEAN
PQPVHLICDLTHRLLACSPARAAQFGVPLGELLDRSLWPYCSEEILRQEATLEELGWRELLAPPALEFASGANASAIVPI
RRSRCRWTRMTLSDGRAVRLVETL
MTEPLPSSSLGPALRRWRLLHRVKQTHAAELLGVAQSTISRWESGTQALLVEERARLERLLGARLEAAADKALARLVEAN
PQPVHLICDLTHRLLACSPARAAQFGVPLGELLDRSLWPYCSEEILRQEATLEELGWRELLAPPALEFASGANASAIVPI
RRSRCRWTRMTLSDGRAVRLVETL
Download Length: 555 bp
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H2Z8V4 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |