Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/HTH_IclR(antitoxin) |
| Location | 855282..856977 | Replicon | chromosome |
| Accession | NZ_CP097857 | ||
| Organism | Pseudomonas sp. B111 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | Q9HYA0 |
| Locus tag | M6E97_RS03925 | Protein ID | WP_003112901.1 |
| Coordinates | 855282..856151 (+) | Length | 290 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | Q9HYA1 |
| Locus tag | M6E97_RS03930 | Protein ID | WP_003112902.1 |
| Coordinates | 856144..856977 (+) | Length | 278 a.a. |
Genomic Context
Location: 851290..852141 (852 bp)
Type: Others
Protein ID: WP_003130104.1
Type: Others
Protein ID: WP_003130104.1
Location: 852182..853189 (1008 bp)
Type: Others
Protein ID: WP_023097315.1
Type: Others
Protein ID: WP_023097315.1
Location: 853186..853962 (777 bp)
Type: Others
Protein ID: WP_003112898.1
Type: Others
Protein ID: WP_003112898.1
Location: 853968..854729 (762 bp)
Type: Others
Protein ID: WP_003112899.1
Type: Others
Protein ID: WP_003112899.1
Location: 854743..855273 (531 bp)
Type: Others
Protein ID: WP_003112900.1
Type: Others
Protein ID: WP_003112900.1
Location: 855282..856151 (870 bp)
Type: Toxin
Protein ID: WP_003112901.1
Type: Toxin
Protein ID: WP_003112901.1
Location: 856144..856977 (834 bp)
Type: Antitoxin
Protein ID: WP_003112902.1
Type: Antitoxin
Protein ID: WP_003112902.1
Location: 856964..857761 (798 bp)
Type: Others
Protein ID: WP_023111480.1
Type: Others
Protein ID: WP_023111480.1
Location: 857754..859436 (1683 bp)
Type: Others
Protein ID: WP_003130114.1
Type: Others
Protein ID: WP_003130114.1
Location: 859447..860250 (804 bp)
Type: Others
Protein ID: WP_003130116.1
Type: Others
Protein ID: WP_003130116.1
Location: 860262..861746 (1485 bp)
Type: Others
Protein ID: WP_023102925.1
Type: Others
Protein ID: WP_023102925.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M6E97_RS03900 (M6E97_03900) | 851290..852141 | + | 852 | WP_003130104.1 | ABC transporter ATP-binding protein | - |
| M6E97_RS03905 (M6E97_03905) | 852182..853189 | + | 1008 | WP_023097315.1 | ABC transporter substrate-binding protein | - |
| M6E97_RS03910 (M6E97_03910) | 853186..853962 | + | 777 | WP_003112898.1 | ABC transporter permease | - |
| M6E97_RS03915 (M6E97_03915) | 853968..854729 | + | 762 | WP_003112899.1 | SDR family oxidoreductase | - |
| M6E97_RS03920 (M6E97_03920) | 854743..855273 | + | 531 | WP_003112900.1 | cupin domain-containing protein | - |
| M6E97_RS03925 (M6E97_03925) | 855282..856151 | + | 870 | WP_003112901.1 | alpha/beta hydrolase | Toxin |
| M6E97_RS03930 (M6E97_03930) | 856144..856977 | + | 834 | WP_003112902.1 | IclR family transcriptional regulator | Antitoxin |
| M6E97_RS03935 (M6E97_03935) | 856964..857761 | + | 798 | WP_023111480.1 | SDR family oxidoreductase | - |
| M6E97_RS03940 (M6E97_03940) | 857754..859436 | + | 1683 | WP_003130114.1 | thiamine pyrophosphate-binding protein | - |
| M6E97_RS03945 (M6E97_03945) | 859447..860250 | + | 804 | WP_003130116.1 | aspartate dehydrogenase | - |
| M6E97_RS03950 (M6E97_03950) | 860262..861746 | + | 1485 | WP_023102925.1 | aldehyde dehydrogenase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 30403.60 Da Isoelectric Point: 6.5894
>T246386 WP_003112901.1 NZ_CP097857:855282-856151 [Pseudomonas sp. B111]
MNMAQTHTPVPNLQQRFPERLVQLADGAQLAIRECGQGPVVVLLHGIGSGSASWLHCAQRLAAGNRVIAWDAPGYGLSTP
LPPARPKACDYAACLELLLDALGVESCLLVGHSLGALMATAYAAGIGAARVRRLVLLSPARGYGAAELRDSGAQVRRQRL
ENLERFGIDGMASERTARLLGRNPSEEALAWVRWNMARLNPEGYRQAVELLCGDDLLGNGQPAAPCEVHCGEDDGITTPE
SCGAIARQLGASFSSIPGAGHASPIEQPEVVAGRIGHAQRLSLEGTANG
MNMAQTHTPVPNLQQRFPERLVQLADGAQLAIRECGQGPVVVLLHGIGSGSASWLHCAQRLAAGNRVIAWDAPGYGLSTP
LPPARPKACDYAACLELLLDALGVESCLLVGHSLGALMATAYAAGIGAARVRRLVLLSPARGYGAAELRDSGAQVRRQRL
ENLERFGIDGMASERTARLLGRNPSEEALAWVRWNMARLNPEGYRQAVELLCGDDLLGNGQPAAPCEVHCGEDDGITTPE
SCGAIARQLGASFSSIPGAGHASPIEQPEVVAGRIGHAQRLSLEGTANG
Download Length: 870 bp
Antitoxin
Download Length: 278 a.a. Molecular weight: 30877.26 Da Isoelectric Point: 5.7725
>AT246386 WP_003112902.1 NZ_CP097857:856144-856977 [Pseudomonas sp. B111]
MDKSDDSQDKYIVPGLERGLLLLCEFSRKDRTLTAPELARRLKLPRSTIFRLLTTLEAMGFVTRNGNEYRLGMAVLRLGF
EYLASLELTELGQPLLNRLCDEIRYPCNLVVRDGRSIVYVAKVSPSTPLSSSVNVGTRLPAHATVLGRILLQDLSLGELR
ELYPEEQLEQFSPNTPRSVLELFDMVQGDRQRGFVQGEGFFEASISTVAAPVRDHSGRVIAAMGATIAAGHIDPERIEGL
VSRVRSSADELSYLLDYRADGQDNVTPIFRSRPHETV
MDKSDDSQDKYIVPGLERGLLLLCEFSRKDRTLTAPELARRLKLPRSTIFRLLTTLEAMGFVTRNGNEYRLGMAVLRLGF
EYLASLELTELGQPLLNRLCDEIRYPCNLVVRDGRSIVYVAKVSPSTPLSSSVNVGTRLPAHATVLGRILLQDLSLGELR
ELYPEEQLEQFSPNTPRSVLELFDMVQGDRQRGFVQGEGFFEASISTVAAPVRDHSGRVIAAMGATIAAGHIDPERIEGL
VSRVRSSADELSYLLDYRADGQDNVTPIFRSRPHETV
Download Length: 834 bp