Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1218607..1219292 Replicon chromosome
Accession NZ_CP097846
Organism Neisseria gonorrhoeae strain AT159

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag M8779_RS06380 Protein ID WP_003689143.1
Coordinates 1218607..1218789 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag M8779_RS06385 Protein ID WP_003691454.1
Coordinates 1218891..1219292 (+) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8779_RS06345 (M8779_06335) 1213622..1214512 - 891 WP_218422938.1 replication protein -
M8779_RS06350 (M8779_06340) 1214709..1214909 - 201 WP_012503750.1 hypothetical protein -
M8779_RS06355 (M8779_06345) 1214911..1215045 - 135 WP_229684436.1 YdaS family helix-turn-helix protein -
M8779_RS06360 (M8779_06350) 1215294..1215947 + 654 WP_157149898.1 helix-turn-helix transcriptional regulator -
M8779_RS06365 (M8779_06355) 1215987..1216685 + 699 WP_002212401.1 S24 family peptidase -
M8779_RS06370 (M8779_06360) 1216903..1217622 + 720 WP_033909072.1 hypothetical protein -
M8779_RS06375 (M8779_06365) 1217619..1218437 + 819 WP_012503752.1 DUF3037 domain-containing protein -
M8779_RS06380 (M8779_06370) 1218607..1218789 + 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
M8779_RS06385 (M8779_06375) 1218891..1219292 + 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
M8779_RS06390 (M8779_06380) 1219391..1220152 - 762 WP_012503753.1 hypothetical protein -
M8779_RS06395 (M8779_06385) 1220373..1220573 + 201 WP_047917349.1 hypothetical protein -
M8779_RS06400 (M8779_06390) 1220606..1221082 + 477 WP_012504141.1 hypothetical protein -
M8779_RS06405 (M8779_06395) 1221079..1221366 + 288 WP_252295574.1 hypothetical protein -
M8779_RS06410 (M8779_06400) 1221507..1221839 + 333 WP_003687946.1 hypothetical protein -
M8779_RS06415 (M8779_06405) 1221992..1222270 + 279 WP_003691529.1 hypothetical protein -
M8779_RS06420 (M8779_06410) 1222267..1222428 + 162 WP_003702497.1 hypothetical protein -
M8779_RS06425 (M8779_06415) 1222497..1223183 + 687 WP_010951053.1 hypothetical protein -
M8779_RS06430 (M8779_06420) 1223323..1223505 + 183 WP_003691535.1 hypothetical protein -
M8779_RS06435 (M8779_06425) 1223502..1223993 + 492 WP_017147227.1 siphovirus Gp157 family protein -
M8779_RS06440 (M8779_06430) 1224045..1224260 + 216 WP_003691538.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1191855..1240418 48563


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T246384 WP_003689143.1 NZ_CP097846:1218607-1218789 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT246384 WP_003691454.1 NZ_CP097846:1218891-1219292 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References