Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 1026923..1027578 | Replicon | chromosome |
Accession | NZ_CP097846 | ||
Organism | Neisseria gonorrhoeae strain AT159 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5F882 |
Locus tag | M8779_RS05330 | Protein ID | WP_003691083.1 |
Coordinates | 1026923..1027342 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | M8779_RS05335 | Protein ID | WP_003688410.1 |
Coordinates | 1027342..1027578 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8779_RS05310 (M8779_05300) | 1022157..1023698 | - | 1542 | WP_172587033.1 | MDR family MFS transporter | - |
M8779_RS05315 (M8779_05305) | 1023846..1024625 | + | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
M8779_RS05320 (M8779_05310) | 1024622..1025323 | + | 702 | WP_003688414.1 | lactate utilization protein C | - |
M8779_RS05325 (M8779_05315) | 1025320..1026774 | + | 1455 | WP_003688412.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
M8779_RS05330 (M8779_05320) | 1026923..1027342 | - | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
M8779_RS05335 (M8779_05325) | 1027342..1027578 | - | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
M8779_RS05340 (M8779_05330) | 1028026..1028604 | - | 579 | WP_003688041.1 | IS3 family transposase | - |
M8779_RS05345 (M8779_05335) | 1028609..1028899 | - | 291 | WP_041420764.1 | helix-turn-helix domain-containing protein | - |
M8779_RS05350 (M8779_05340) | 1029249..1029635 | + | 387 | Protein_1054 | IS110 family transposase | - |
M8779_RS05355 (M8779_05345) | 1030018..1030908 | - | 891 | WP_003688409.1 | succinate--CoA ligase subunit alpha | - |
M8779_RS05360 (M8779_05350) | 1030919..1032085 | - | 1167 | WP_003688408.1 | ADP-forming succinate--CoA ligase subunit beta | - |
M8779_RS05365 (M8779_05355) | 1032157..1032444 | - | 288 | WP_003688407.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T246383 WP_003691083.1 NZ_CP097846:c1027342-1026923 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|