Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 130712..131337 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP097841 | ||
| Organism | Shigella flexneri strain A | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | M9382_RS23565 | Protein ID | WP_000911087.1 |
| Coordinates | 130712..131110 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | Q7BEJ0 |
| Locus tag | M9382_RS23570 | Protein ID | WP_000450531.1 |
| Coordinates | 131110..131337 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9382_RS23540 (M9382_23540) | 126313..127263 | + | 951 | WP_004970430.1 | virulence factor VirK | - |
| M9382_RS23545 (M9382_23545) | 127328..128272 | + | 945 | WP_004996485.1 | lauroyl-Kdo(2)-lipid IV(A) myristoyltransferase | - |
| M9382_RS23550 (M9382_23550) | 128426..129279 | - | 854 | Protein_154 | IS630 family transposase | - |
| M9382_RS23560 (M9382_23560) | 130524..130703 | + | 180 | Protein_156 | hypothetical protein | - |
| M9382_RS23565 (M9382_23565) | 130712..131110 | - | 399 | WP_000911087.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| M9382_RS23570 (M9382_23570) | 131110..131337 | - | 228 | WP_000450531.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | ipaH7.8 / ospD3/senA / ospC1 / ospC3 / ipaJ / ipaA / ipaD / ipaC / ipaB / ipgC / ipgB1 / ipgA / icsB / ipgD / ipgE / ipgF / mxiG / mxiH / mxiI / mxiJ / mxiK / mxiN / mxiL / mxiM / mxiE / mxiD / mxiC / mxiA / spa15 / spa47 / spa13 / spa32 / spa33 / spa24 / spa9 / spa29 / spa40 / virA / icsA/virG / papC / ospI / ipaH9.8 / ospG / ipaH1.4 / ospE1 / nleE / icsP/sopA / ospB / ospD2 / ospF / ospD1 / ipgB2 / ospE2 / ipaH2.5 / ospC2 / ipaH7.8 | 1..217683 | 217683 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14799.04 Da Isoelectric Point: 8.5232
>T246378 WP_000911087.1 NZ_CP097841:c131110-130712 [Shigella flexneri]
MLKFILDTNICIFTIKNKPASVRERFNLNQGKMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRTEDWS
MLKFILDTNICIFTIKNKPASVRERFNLNQGKMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRTEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|