Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 113209..113734 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP097841 | ||
| Organism | Shigella flexneri strain A | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | Q326Z8 |
| Locus tag | M9382_RS23465 | Protein ID | WP_001159860.1 |
| Coordinates | 113429..113734 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | Q7BEK0 |
| Locus tag | M9382_RS23460 | Protein ID | WP_000813626.1 |
| Coordinates | 113209..113427 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9382_RS23430 (M9382_23430) | 108934..109119 | + | 186 | Protein_130 | ATP-binding protein | - |
| M9382_RS23435 (M9382_23435) | 109219..109428 | - | 210 | Protein_131 | peptidoglycan-binding protein | - |
| M9382_RS23440 (M9382_23440) | 110182..110466 | + | 285 | WP_024260696.1 | ribbon-helix-helix domain-containing protein | - |
| M9382_RS23445 (M9382_23445) | 110466..110741 | + | 276 | WP_000421262.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| M9382_RS23455 (M9382_23455) | 111720..112673 | + | 954 | Protein_135 | IS66 family transposase | - |
| M9382_RS23460 (M9382_23460) | 113209..113427 | + | 219 | WP_000813626.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| M9382_RS23465 (M9382_23465) | 113429..113734 | + | 306 | WP_001159860.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| M9382_RS23470 (M9382_23470) | 113758..113865 | + | 108 | WP_023592908.1 | transposase domain-containing protein | - |
| M9382_RS23475 (M9382_23475) | 114127..115764 | + | 1638 | WP_000936806.1 | T3SS effector E3 ubiquitin-protein ligase IpaH9.8 | - |
| M9382_RS23480 (M9382_23480) | 115972..116241 | + | 270 | Protein_140 | type II toxin-antitoxin system antitoxin YacA | - |
| M9382_RS23485 (M9382_23485) | 116241..116410 | + | 170 | Protein_141 | type II toxin-antitoxin system toxin YacB | - |
| M9382_RS23490 (M9382_23490) | 116493..117083 | + | 591 | WP_000705601.1 | type III secretion system effector protein kinase OspG | - |
| M9382_RS23495 (M9382_23495) | 117440..117706 | + | 267 | Protein_143 | IS66 family insertion sequence element accessory protein TnpB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | ipaH7.8 / ospD3/senA / ospC1 / ospC3 / ipaJ / ipaA / ipaD / ipaC / ipaB / ipgC / ipgB1 / ipgA / icsB / ipgD / ipgE / ipgF / mxiG / mxiH / mxiI / mxiJ / mxiK / mxiN / mxiL / mxiM / mxiE / mxiD / mxiC / mxiA / spa15 / spa47 / spa13 / spa32 / spa33 / spa24 / spa9 / spa29 / spa40 / virA / icsA/virG / papC / ospI / ipaH9.8 / ospG / ipaH1.4 / ospE1 / nleE / icsP/sopA / ospB / ospD2 / ospF / ospD1 / ipgB2 / ospE2 / ipaH2.5 / ospC2 / ipaH7.8 | 1..217683 | 217683 | |
| - | inside | IScluster/Tn | - | ospI / ipaH9.8 / ospG | 98586..120303 | 21717 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11736.59 Da Isoelectric Point: 6.4674
>T246377 WP_001159860.1 NZ_CP097841:113429-113734 [Shigella flexneri]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPIFVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPIFVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TTN3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q7BEK0 |