Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 113209..113734 Replicon plasmid unnamed1
Accession NZ_CP097841
Organism Shigella flexneri strain A

Toxin (Protein)


Gene name ccdB Uniprot ID Q326Z8
Locus tag M9382_RS23465 Protein ID WP_001159860.1
Coordinates 113429..113734 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID Q7BEK0
Locus tag M9382_RS23460 Protein ID WP_000813626.1
Coordinates 113209..113427 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9382_RS23430 (M9382_23430) 108934..109119 + 186 Protein_130 ATP-binding protein -
M9382_RS23435 (M9382_23435) 109219..109428 - 210 Protein_131 peptidoglycan-binding protein -
M9382_RS23440 (M9382_23440) 110182..110466 + 285 WP_024260696.1 ribbon-helix-helix domain-containing protein -
M9382_RS23445 (M9382_23445) 110466..110741 + 276 WP_000421262.1 type II toxin-antitoxin system RelE/ParE family toxin -
M9382_RS23455 (M9382_23455) 111720..112673 + 954 Protein_135 IS66 family transposase -
M9382_RS23460 (M9382_23460) 113209..113427 + 219 WP_000813626.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
M9382_RS23465 (M9382_23465) 113429..113734 + 306 WP_001159860.1 type II toxin-antitoxin system toxin CcdB Toxin
M9382_RS23470 (M9382_23470) 113758..113865 + 108 WP_023592908.1 transposase domain-containing protein -
M9382_RS23475 (M9382_23475) 114127..115764 + 1638 WP_000936806.1 T3SS effector E3 ubiquitin-protein ligase IpaH9.8 -
M9382_RS23480 (M9382_23480) 115972..116241 + 270 Protein_140 type II toxin-antitoxin system antitoxin YacA -
M9382_RS23485 (M9382_23485) 116241..116410 + 170 Protein_141 type II toxin-antitoxin system toxin YacB -
M9382_RS23490 (M9382_23490) 116493..117083 + 591 WP_000705601.1 type III secretion system effector protein kinase OspG -
M9382_RS23495 (M9382_23495) 117440..117706 + 267 Protein_143 IS66 family insertion sequence element accessory protein TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - ipaH7.8 / ospD3/senA / ospC1 / ospC3 / ipaJ / ipaA / ipaD / ipaC / ipaB / ipgC / ipgB1 / ipgA / icsB / ipgD / ipgE / ipgF / mxiG / mxiH / mxiI / mxiJ / mxiK / mxiN / mxiL / mxiM / mxiE / mxiD / mxiC / mxiA / spa15 / spa47 / spa13 / spa32 / spa33 / spa24 / spa9 / spa29 / spa40 / virA / icsA/virG / papC / ospI / ipaH9.8 / ospG / ipaH1.4 / ospE1 / nleE / icsP/sopA / ospB / ospD2 / ospF / ospD1 / ipgB2 / ospE2 / ipaH2.5 / ospC2 / ipaH7.8 1..217683 217683
- inside IScluster/Tn - ospI / ipaH9.8 / ospG 98586..120303 21717


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11736.59 Da        Isoelectric Point: 6.4674

>T246377 WP_001159860.1 NZ_CP097841:113429-113734 [Shigella flexneri]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPIFVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8333.36 Da        Isoelectric Point: 6.2838

>AT246377 WP_000813626.1 NZ_CP097841:113209-113427 [Shigella flexneri]
MKQRITVTIDSDSYQLLKSANVNISGLVNTAMQKEARRLRAERWQAENQQGMAEIARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TTN3

Antitoxin

Source ID Structure
AlphaFold DB Q7BEK0

References