Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 110182..110741 Replicon plasmid unnamed1
Accession NZ_CP097841
Organism Shigella flexneri strain A

Toxin (Protein)


Gene name relE Uniprot ID D2AJT2
Locus tag M9382_RS23445 Protein ID WP_000421262.1
Coordinates 110466..110741 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag M9382_RS23440 Protein ID WP_024260696.1
Coordinates 110182..110466 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9382_RS23415 (M9382_23415) 106126..106800 + 675 WP_004967157.1 IS66-like element accessory protein TnpA -
M9382_RS23420 (M9382_23420) 106797..107147 + 351 WP_005061851.1 IS66 family insertion sequence element accessory protein TnpB -
M9382_RS23425 (M9382_23425) 107144..108745 + 1602 WP_134797205.1 IS66-like element ISSfl3 family transposase -
M9382_RS23430 (M9382_23430) 108934..109119 + 186 Protein_130 ATP-binding protein -
M9382_RS23435 (M9382_23435) 109219..109428 - 210 Protein_131 peptidoglycan-binding protein -
M9382_RS23440 (M9382_23440) 110182..110466 + 285 WP_024260696.1 ribbon-helix-helix domain-containing protein Antitoxin
M9382_RS23445 (M9382_23445) 110466..110741 + 276 WP_000421262.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M9382_RS23455 (M9382_23455) 111720..112673 + 954 Protein_135 IS66 family transposase -
M9382_RS23460 (M9382_23460) 113209..113427 + 219 WP_000813626.1 type II toxin-antitoxin system antitoxin CcdA -
M9382_RS23465 (M9382_23465) 113429..113734 + 306 WP_001159860.1 type II toxin-antitoxin system toxin CcdB -
M9382_RS23470 (M9382_23470) 113758..113865 + 108 WP_023592908.1 transposase domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - ipaH7.8 / ospD3/senA / ospC1 / ospC3 / ipaJ / ipaA / ipaD / ipaC / ipaB / ipgC / ipgB1 / ipgA / icsB / ipgD / ipgE / ipgF / mxiG / mxiH / mxiI / mxiJ / mxiK / mxiN / mxiL / mxiM / mxiE / mxiD / mxiC / mxiA / spa15 / spa47 / spa13 / spa32 / spa33 / spa24 / spa9 / spa29 / spa40 / virA / icsA/virG / papC / ospI / ipaH9.8 / ospG / ipaH1.4 / ospE1 / nleE / icsP/sopA / ospB / ospD2 / ospF / ospD1 / ipgB2 / ospE2 / ipaH2.5 / ospC2 / ipaH7.8 1..217683 217683
- inside IScluster/Tn - ospI / ipaH9.8 / ospG 98586..120303 21717


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10766.48 Da        Isoelectric Point: 9.9324

>T246376 WP_000421262.1 NZ_CP097841:110466-110741 [Shigella flexneri]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFTGEYEIRYELTGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10513.93 Da        Isoelectric Point: 6.2150

>AT246376 WP_024260696.1 NZ_CP097841:110182-110466 [Shigella flexneri]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQSW
ADSLSTDHPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A822PVM3

Antitoxin

Source ID Structure

References