Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/ElaA-DUF1778
Location 21584..22341 Replicon plasmid unnamed1
Accession NZ_CP097841
Organism Shigella flexneri strain A

Toxin (Protein)


Gene name tacT Uniprot ID D2AJG5
Locus tag M9382_RS22925 Protein ID WP_000501974.1
Coordinates 21584..22069 (-) Length 162 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID Q31SN8
Locus tag M9382_RS22930 Protein ID WP_011114751.1
Coordinates 22057..22341 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9382_RS22895 (M9382_22895) 17109..17533 - 425 Protein_23 hypothetical protein -
M9382_RS22900 (M9382_22900) 17761..18399 - 639 WP_000502862.1 ParB N-terminal domain-containing protein -
M9382_RS22905 (M9382_22905) 18384..18527 - 144 Protein_25 DUF3440 domain-containing protein -
M9382_RS22920 (M9382_22920) 21130..21411 + 282 Protein_28 IS4/IS5 family transposase -
M9382_RS22925 (M9382_22925) 21584..22069 - 486 WP_000501974.1 GNAT family N-acetyltransferase Toxin
M9382_RS22930 (M9382_22930) 22057..22341 - 285 WP_011114751.1 DUF1778 domain-containing protein Antitoxin
M9382_RS22935 (M9382_22935) 23243..23407 + 165 WP_001346193.1 hypothetical protein -
M9382_RS22940 (M9382_22940) 23661..25262 - 1602 WP_005063916.1 IS66-like element ISSfl3 family transposase -
M9382_RS22945 (M9382_22945) 25259..25609 - 351 WP_005048975.1 IS66 family insertion sequence element accessory protein TnpB -
M9382_RS22950 (M9382_22950) 25606..26280 - 675 WP_001088287.1 IS66-like element accessory protein TnpA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - ipaH7.8 / ospD3/senA / ospC1 / ospC3 / ipaJ / ipaA / ipaD / ipaC / ipaB / ipgC / ipgB1 / ipgA / icsB / ipgD / ipgE / ipgF / mxiG / mxiH / mxiI / mxiJ / mxiK / mxiN / mxiL / mxiM / mxiE / mxiD / mxiC / mxiA / spa15 / spa47 / spa13 / spa32 / spa33 / spa24 / spa9 / spa29 / spa40 / virA / icsA/virG / papC / ospI / ipaH9.8 / ospG / ipaH1.4 / ospE1 / nleE / icsP/sopA / ospB / ospD2 / ospF / ospD1 / ipgB2 / ospE2 / ipaH2.5 / ospC2 / ipaH7.8 1..217683 217683
- inside IScluster/Tn - ospD3/senA / ospC1 / ospC3 340..35023 34683


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(27-151)

Antitoxin

Vibrio phage ICP1, Orf50

(12-88)


Sequences

Toxin        


Download         Length: 162 a.a.        Molecular weight: 17814.63 Da        Isoelectric Point: 9.8822

>T246375 WP_000501974.1 NZ_CP097841:c22069-21584 [Shigella flexneri]
MGCVTAPEPLSSFHQVAEFVSSEAVLDDWLKQKELKNQAIGATRTFVVCRKGTQQIVGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDVSFRGKGLGADLLHDAVRRCYRVAENIGVRAIMVHALTENAKQFYIHHGFKPSKTQVQTLFLKLP
Q

Download         Length: 486 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10871.52 Da        Isoelectric Point: 4.6812

>AT246375 WP_011114751.1 NZ_CP097841:c22341-22057 [Shigella flexneri]
MIYGGFMKSGVQLNLRARESQRILIDAAAEILHKSRTDFILEMACKAAEDVILDRRVFNFNDRQYEEFIEMLDAPVADDP
AIEKLLARKPQWDV

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A822PN28

Antitoxin

Source ID Structure
AlphaFold DB A0A4V1CUJ1

References