Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1796620..1797274 | Replicon | chromosome |
Accession | NZ_CP097840 | ||
Organism | Shigella flexneri strain A |
Toxin (Protein)
Gene name | cptA | Uniprot ID | Q0T101 |
Locus tag | M9382_RS08715 | Protein ID | WP_000244767.1 |
Coordinates | 1796867..1797274 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | Q0T100 |
Locus tag | M9382_RS08710 | Protein ID | WP_000354044.1 |
Coordinates | 1796620..1796886 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9382_RS08685 (1791791) | 1791791..1792533 | + | 743 | Protein_1687 | SDR family oxidoreductase | - |
M9382_RS08690 (1792590) | 1792590..1794023 | - | 1434 | WP_005076748.1 | 6-phospho-beta-glucosidase BglA | - |
M9382_RS08695 (1794068) | 1794068..1794378 | + | 311 | Protein_1689 | N(4)-acetylcytidine aminohydrolase | - |
M9382_RS08700 (1794542) | 1794542..1795201 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
M9382_RS08705 (1795397) | 1795397..1796377 | - | 981 | WP_000886065.1 | tRNA-modifying protein YgfZ | - |
M9382_RS08710 (1796620) | 1796620..1796886 | + | 267 | WP_000354044.1 | FAD assembly factor SdhE | Antitoxin |
M9382_RS08715 (1796867) | 1796867..1797274 | + | 408 | WP_000244767.1 | protein YgfX | Toxin |
M9382_RS08720 (1797314) | 1797314..1797835 | - | 522 | WP_001055867.1 | flavodoxin FldB | - |
M9382_RS08725 (1797947) | 1797947..1798843 | + | 897 | WP_000806987.1 | site-specific tyrosine recombinase XerD | - |
M9382_RS08730 (1798868) | 1798868..1799578 | + | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
M9382_RS08735 (1799584) | 1799584..1801317 | + | 1734 | WP_000813187.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15978.91 Da Isoelectric Point: 10.9373
>T246363 WP_000244767.1 NZ_CP097840:1796867-1797274 [Shigella flexneri]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRCINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRCINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TIU0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TIU2 |