Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 196950..197725 Replicon plasmid unnamed2
Accession NZ_CP097839
Organism Shigella flexneri strain B

Toxin (Protein)


Gene name tacT Uniprot ID Q7BEG9
Locus tag M9380_RS24410 Protein ID WP_000405245.1
Coordinates 196950..197432 (-) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID Q7BEG8
Locus tag M9380_RS24415 Protein ID WP_010921625.1
Coordinates 197423..197725 (-) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9380_RS24395 (M9380_24380) 193364..195055 + 1692 WP_134797093.1 IpaH family type III secretion system E3 ubiquitin--protein ligase -
M9380_RS24400 (M9380_24385) 195107..196316 + 1210 Protein_240 IS3 family transposase -
M9380_RS24405 (M9380_24390) 196359..196882 - 524 Protein_241 IS3-like element ISSfl11 family transposase -
M9380_RS24410 (M9380_24395) 196950..197432 - 483 WP_000405245.1 GNAT family N-acetyltransferase Toxin
M9380_RS24415 (M9380_24400) 197423..197725 - 303 WP_010921625.1 DUF1778 domain-containing protein Antitoxin
M9380_RS24420 (M9380_24405) 197997..198269 + 273 WP_258249732.1 hypothetical protein -
M9380_RS24425 (M9380_24410) 198250..199457 + 1208 WP_094096874.1 IS91 family transposase -
M9380_RS24430 (M9380_24415) 199629..199757 + 129 Protein_246 IS5/IS1182 family transposase -
M9380_RS24435 (M9380_24420) 199906..201360 - 1455 WP_075332747.1 type 3 secretion system effector OspC2 -
M9380_RS24440 (M9380_24425) 201764..202383 + 620 Protein_248 IS1 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - ospD3/senA / ospC1 / ospC3 / ipaJ / ipaA / ipaD / ipaC / ipaB / ipgC / ipgB1 / ipgA / icsB / ipgD / ipgE / ipgF / mxiG / mxiH / mxiI / mxiJ / mxiK / mxiN / mxiL / mxiM / mxiE / mxiD / mxiC / mxiA / spa15 / spa47 / spa13 / spa32 / spa33 / spa24 / spa9 / spa29 / spa40 / virA / icsA/virG / papC / ospI / ipaH9.8 / ospG / ipaH1.4 / ospE1 / nleE / icsP/sopA / ospB / ospD2 / ospF / ospD1 / ipgB2 / ospE2 / ipaH2.5 / ospC2 / ipaH7.8 / ipaH4.5 1..217680 217680
- inside IScluster/Tn - ospE2 / ipaH2.5 / ospC2 182935..204742 21807


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(29-149)

Antitoxin

Vibrio phage ICP1, Orf50

(19-94)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17750.52 Da        Isoelectric Point: 7.0382

>T246359 WP_000405245.1 NZ_CP097839:c197432-196950 [Shigella flexneri]
MEINVTAPALLTDEHILQPFDCGNEVLSNWLRGRAMKNQMLNASRTFVICLEDTLRIVGYYSLATGSVTHAELGRSLRHN
MPNPVPVVLLGRLAVDVCTQGHGFGKWLLSDAIHRVVNLADQVGIKAVMVHAIDDDARAFYERFGFVQSVVAPNTLFYKV

Download         Length: 483 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11689.28 Da        Isoelectric Point: 4.9167

>AT246359 WP_010921625.1 NZ_CP097839:c197725-197423 [Shigella flexneri]
MEVFMSTAASVRKTPREHQINIRATDEERAVIDYAASLVNKNRTDFIMELAYQEAKNIILDQRLFVLDNERYDSFITQLE
APVQNAEGRERLMAVKPEWK

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q7BEG9

Antitoxin

Source ID Structure
AlphaFold DB Q7BEG8

References