246357

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 112747..113272 Replicon plasmid unnamed2
Accession NZ_CP097839
Organism Shigella flexneri strain B

Toxin (Protein)


Gene name ccdB Uniprot ID Q326Z8
Locus tag M9380_RS23880 Protein ID WP_001159860.1
Coordinates 112967..113272 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID Q7BEK0
Locus tag M9380_RS23875 Protein ID WP_000813626.1
Coordinates 112747..112965 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9380_RS23840 (M9380_23830) 108473..108658 + 186 Protein_129 ATP-binding protein -
M9380_RS23845 (M9380_23835) 108758..108967 - 210 Protein_130 peptidoglycan-binding protein -
M9380_RS23850 (M9380_23840) 109017..109268 - 252 WP_001381727.1 transporter -
M9380_RS23855 (M9380_23845) 109720..110004 + 285 WP_024260696.1 ribbon-helix-helix domain-containing protein -
M9380_RS23860 (M9380_23850) 110004..110279 + 276 WP_000421262.1 type II toxin-antitoxin system RelE/ParE family toxin -
M9380_RS23870 (M9380_23860) 111258..112211 + 954 Protein_135 IS66 family transposase -
M9380_RS23875 (M9380_23865) 112747..112965 + 219 WP_000813626.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
M9380_RS23880 (M9380_23870) 112967..113272 + 306 WP_001159860.1 type II toxin-antitoxin system toxin CcdB Toxin
M9380_RS23885 (M9380_23875) 113296..113403 + 108 WP_023592908.1 transposase domain-containing protein -
M9380_RS23890 (M9380_23880) 113665..115302 + 1638 WP_000936806.1 T3SS effector E3 ubiquitin-protein ligase IpaH9.8 -
M9380_RS23895 (M9380_23885) 115510..115779 + 270 Protein_140 type II toxin-antitoxin system antitoxin YacA -
M9380_RS23900 (M9380_23890) 115779..115948 + 170 Protein_141 type II toxin-antitoxin system toxin YacB -
M9380_RS23905 (M9380_23895) 116031..116621 + 591 WP_000705601.1 type III secretion system effector protein kinase OspG -
M9380_RS23910 (M9380_23900) 116978..117244 + 267 Protein_143 IS66 family insertion sequence element accessory protein TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - ospD3/senA / ospC1 / ospC3 / ipaJ / ipaA / ipaD / ipaC / ipaB / ipgC / ipgB1 / ipgA / icsB / ipgD / ipgE / ipgF / mxiG / mxiH / mxiI / mxiJ / mxiK / mxiN / mxiL / mxiM / mxiE / mxiD / mxiC / mxiA / spa15 / spa47 / spa13 / spa32 / spa33 / spa24 / spa9 / spa29 / spa40 / virA / icsA/virG / papC / ospI / ipaH9.8 / ospG / ipaH1.4 / ospE1 / nleE / icsP/sopA / ospB / ospD2 / ospF / ospD1 / ipgB2 / ospE2 / ipaH2.5 / ospC2 / ipaH7.8 / ipaH4.5 1..217680 217680
- inside IScluster/Tn - ospI / ipaH9.8 / ospG 98125..119841 21716


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11736.59 Da        Isoelectric Point: 6.4674

>T246357 WP_001159860.1 NZ_CP097839:112967-113272 [Shigella flexneri]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPIFVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8333.36 Da        Isoelectric Point: 6.2838

>AT246357 WP_000813626.1 NZ_CP097839:112747-112965 [Shigella flexneri]
MKQRITVTIDSDSYQLLKSANVNISGLVNTAMQKEARRLRAERWQAENQQGMAEIARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TTN3

Antitoxin

Source ID Structure
AlphaFold DB Q7BEK0

References