Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 112747..113272 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP097839 | ||
| Organism | Shigella flexneri strain B | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | Q326Z8 |
| Locus tag | M9380_RS23880 | Protein ID | WP_001159860.1 |
| Coordinates | 112967..113272 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | Q7BEK0 |
| Locus tag | M9380_RS23875 | Protein ID | WP_000813626.1 |
| Coordinates | 112747..112965 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9380_RS23840 (M9380_23830) | 108473..108658 | + | 186 | Protein_129 | ATP-binding protein | - |
| M9380_RS23845 (M9380_23835) | 108758..108967 | - | 210 | Protein_130 | peptidoglycan-binding protein | - |
| M9380_RS23850 (M9380_23840) | 109017..109268 | - | 252 | WP_001381727.1 | transporter | - |
| M9380_RS23855 (M9380_23845) | 109720..110004 | + | 285 | WP_024260696.1 | ribbon-helix-helix domain-containing protein | - |
| M9380_RS23860 (M9380_23850) | 110004..110279 | + | 276 | WP_000421262.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| M9380_RS23870 (M9380_23860) | 111258..112211 | + | 954 | Protein_135 | IS66 family transposase | - |
| M9380_RS23875 (M9380_23865) | 112747..112965 | + | 219 | WP_000813626.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| M9380_RS23880 (M9380_23870) | 112967..113272 | + | 306 | WP_001159860.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| M9380_RS23885 (M9380_23875) | 113296..113403 | + | 108 | WP_023592908.1 | transposase domain-containing protein | - |
| M9380_RS23890 (M9380_23880) | 113665..115302 | + | 1638 | WP_000936806.1 | T3SS effector E3 ubiquitin-protein ligase IpaH9.8 | - |
| M9380_RS23895 (M9380_23885) | 115510..115779 | + | 270 | Protein_140 | type II toxin-antitoxin system antitoxin YacA | - |
| M9380_RS23900 (M9380_23890) | 115779..115948 | + | 170 | Protein_141 | type II toxin-antitoxin system toxin YacB | - |
| M9380_RS23905 (M9380_23895) | 116031..116621 | + | 591 | WP_000705601.1 | type III secretion system effector protein kinase OspG | - |
| M9380_RS23910 (M9380_23900) | 116978..117244 | + | 267 | Protein_143 | IS66 family insertion sequence element accessory protein TnpB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | ospD3/senA / ospC1 / ospC3 / ipaJ / ipaA / ipaD / ipaC / ipaB / ipgC / ipgB1 / ipgA / icsB / ipgD / ipgE / ipgF / mxiG / mxiH / mxiI / mxiJ / mxiK / mxiN / mxiL / mxiM / mxiE / mxiD / mxiC / mxiA / spa15 / spa47 / spa13 / spa32 / spa33 / spa24 / spa9 / spa29 / spa40 / virA / icsA/virG / papC / ospI / ipaH9.8 / ospG / ipaH1.4 / ospE1 / nleE / icsP/sopA / ospB / ospD2 / ospF / ospD1 / ipgB2 / ospE2 / ipaH2.5 / ospC2 / ipaH7.8 / ipaH4.5 | 1..217680 | 217680 | |
| - | inside | IScluster/Tn | - | ospI / ipaH9.8 / ospG | 98125..119841 | 21716 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11736.59 Da Isoelectric Point: 6.4674
>T246357 WP_001159860.1 NZ_CP097839:112967-113272 [Shigella flexneri]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPIFVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPIFVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TTN3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q7BEK0 |