Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 109720..110279 Replicon plasmid unnamed2
Accession NZ_CP097839
Organism Shigella flexneri strain B

Toxin (Protein)


Gene name relE Uniprot ID D2AJT2
Locus tag M9380_RS23860 Protein ID WP_000421262.1
Coordinates 110004..110279 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag M9380_RS23855 Protein ID WP_024260696.1
Coordinates 109720..110004 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9380_RS23825 (M9380_23815) 105665..106339 + 675 WP_004967157.1 IS66-like element accessory protein TnpA -
M9380_RS23830 (M9380_23820) 106336..106686 + 351 WP_005061851.1 IS66 family insertion sequence element accessory protein TnpB -
M9380_RS23835 (M9380_23825) 106683..108284 + 1602 WP_134797205.1 IS66-like element ISSfl3 family transposase -
M9380_RS23840 (M9380_23830) 108473..108658 + 186 Protein_129 ATP-binding protein -
M9380_RS23845 (M9380_23835) 108758..108967 - 210 Protein_130 peptidoglycan-binding protein -
M9380_RS23850 (M9380_23840) 109017..109268 - 252 WP_001381727.1 transporter -
M9380_RS23855 (M9380_23845) 109720..110004 + 285 WP_024260696.1 ribbon-helix-helix domain-containing protein Antitoxin
M9380_RS23860 (M9380_23850) 110004..110279 + 276 WP_000421262.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M9380_RS23870 (M9380_23860) 111258..112211 + 954 Protein_135 IS66 family transposase -
M9380_RS23875 (M9380_23865) 112747..112965 + 219 WP_000813626.1 type II toxin-antitoxin system antitoxin CcdA -
M9380_RS23880 (M9380_23870) 112967..113272 + 306 WP_001159860.1 type II toxin-antitoxin system toxin CcdB -
M9380_RS23885 (M9380_23875) 113296..113403 + 108 WP_023592908.1 transposase domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - ospD3/senA / ospC1 / ospC3 / ipaJ / ipaA / ipaD / ipaC / ipaB / ipgC / ipgB1 / ipgA / icsB / ipgD / ipgE / ipgF / mxiG / mxiH / mxiI / mxiJ / mxiK / mxiN / mxiL / mxiM / mxiE / mxiD / mxiC / mxiA / spa15 / spa47 / spa13 / spa32 / spa33 / spa24 / spa9 / spa29 / spa40 / virA / icsA/virG / papC / ospI / ipaH9.8 / ospG / ipaH1.4 / ospE1 / nleE / icsP/sopA / ospB / ospD2 / ospF / ospD1 / ipgB2 / ospE2 / ipaH2.5 / ospC2 / ipaH7.8 / ipaH4.5 1..217680 217680
- inside IScluster/Tn - ospI / ipaH9.8 / ospG 98125..119841 21716


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10766.48 Da        Isoelectric Point: 9.9324

>T246356 WP_000421262.1 NZ_CP097839:110004-110279 [Shigella flexneri]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFTGEYEIRYELTGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10513.93 Da        Isoelectric Point: 6.2150

>AT246356 WP_024260696.1 NZ_CP097839:109720-110004 [Shigella flexneri]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQSW
ADSLSTDHPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A822PVM3

Antitoxin

Source ID Structure

References