Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 4057759..4058390 | Replicon | chromosome |
Accession | NZ_CP097837 | ||
Organism | Shigella flexneri strain B |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | M9380_RS20605 | Protein ID | WP_025760846.1 |
Coordinates | 4058115..4058390 (-) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | U9Y7E1 |
Locus tag | M9380_RS20600 | Protein ID | WP_000593555.1 |
Coordinates | 4057759..4058118 (-) | Length | 120 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9380_RS20575 (4053891) | 4053891..4054835 | + | 945 | WP_000947076.1 | nickel ABC transporter permease subunit NikB | - |
M9380_RS20580 (4054832) | 4054832..4055665 | + | 834 | WP_001008974.1 | nickel ABC transporter permease subunit NikC | - |
M9380_RS20585 (4055665) | 4055665..4056429 | + | 765 | WP_001136248.1 | nickel import ATP-binding protein NikD | - |
M9380_RS20590 (4056426) | 4056426..4057232 | + | 807 | WP_000173660.1 | nickel import ATP-binding protein NikE | - |
M9380_RS20595 (4057238) | 4057238..4057639 | + | 402 | WP_001190062.1 | nickel-responsive transcriptional regulator NikR | - |
M9380_RS20600 (4057759) | 4057759..4058118 | - | 360 | WP_000593555.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
M9380_RS20605 (4058115) | 4058115..4058390 | - | 276 | WP_025760846.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
M9380_RS20610 (4058449) | 4058449..4059573 | - | 1125 | WP_001216257.1 | ABC transporter permease | - |
M9380_RS20615 (4059573) | 4059573..4062308 | - | 2736 | WP_000149172.1 | ribosome-associated ATPase/putative transporter RbbA | - |
M9380_RS20620 (4062305) | 4062305..4063372 | - | 1068 | WP_000361470.1 | HlyD family secretion protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10145.95 Da Isoelectric Point: 10.6469
>T246353 WP_025760846.1 NZ_CP097837:c4058390-4058115 [Shigella flexneri]
MRTKVQALRKKQKNTLDQIFKTPVPQGIKWSDIESLVKALGGEIKKGRGSRCKFILNMSVACFHRPHPSPDTDKGAVESV
CDWLLSIGVKP
MRTKVQALRKKQKNTLDQIFKTPVPQGIKWSDIESLVKALGGEIKKGRGSRCKFILNMSVACFHRPHPSPDTDKGAVESV
CDWLLSIGVKP
Download Length: 276 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13402.27 Da Isoelectric Point: 5.1987
>AT246353 WP_000593555.1 NZ_CP097837:c4058118-4057759 [Shigella flexneri]
MIKLKTPNSMEIAGQPAVITYVPELNAFRGKFLGLSGYCDFVSDSIQGLQKEGELSLREYLEDCKAAGIEPYARTEKIKT
FTLRYPESLSERLNNAAAQQQVSVNTYIIETLNERLNHL
MIKLKTPNSMEIAGQPAVITYVPELNAFRGKFLGLSGYCDFVSDSIQGLQKEGELSLREYLEDCKAAGIEPYARTEKIKT
FTLRYPESLSERLNNAAAQQQVSVNTYIIETLNERLNHL
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|