Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3496552..3497206 | Replicon | chromosome |
| Accession | NZ_CP097837 | ||
| Organism | Shigella flexneri strain B | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | Q0T101 |
| Locus tag | M9380_RS17715 | Protein ID | WP_000244767.1 |
| Coordinates | 3496552..3496959 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | Q0T100 |
| Locus tag | M9380_RS17720 | Protein ID | WP_000354044.1 |
| Coordinates | 3496940..3497206 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9380_RS17695 (3492509) | 3492509..3494242 | - | 1734 | WP_000813187.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| M9380_RS17700 (3494248) | 3494248..3494958 | - | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M9380_RS17705 (3494983) | 3494983..3495879 | - | 897 | WP_000806987.1 | site-specific tyrosine recombinase XerD | - |
| M9380_RS17710 (3495991) | 3495991..3496512 | + | 522 | WP_001055867.1 | flavodoxin FldB | - |
| M9380_RS17715 (3496552) | 3496552..3496959 | - | 408 | WP_000244767.1 | protein YgfX | Toxin |
| M9380_RS17720 (3496940) | 3496940..3497206 | - | 267 | WP_000354044.1 | FAD assembly factor SdhE | Antitoxin |
| M9380_RS17725 (3497449) | 3497449..3498429 | + | 981 | WP_000886065.1 | tRNA-modifying protein YgfZ | - |
| M9380_RS17730 (3498625) | 3498625..3499284 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| M9380_RS17735 (3499448) | 3499448..3499758 | - | 311 | Protein_3443 | N(4)-acetylcytidine aminohydrolase | - |
| M9380_RS17740 (3499803) | 3499803..3501236 | + | 1434 | WP_005076748.1 | 6-phospho-beta-glucosidase BglA | - |
| M9380_RS17745 (3501293) | 3501293..3502035 | - | 743 | Protein_3445 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15978.91 Da Isoelectric Point: 10.9373
>T246351 WP_000244767.1 NZ_CP097837:c3496959-3496552 [Shigella flexneri]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRCINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRCINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TIU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TIU2 |