Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 213143..213768 | Replicon | plasmid unnamed2 |
Accession | NZ_CP097836 | ||
Organism | Shigella flexneri strain C |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M9379_RS24455 | Protein ID | WP_000911087.1 |
Coordinates | 213370..213768 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q7BEJ0 |
Locus tag | M9379_RS24450 | Protein ID | WP_000450531.1 |
Coordinates | 213143..213370 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9379_RS24450 (M9379_24450) | 213143..213370 | + | 228 | WP_000450531.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
M9379_RS24455 (M9379_24455) | 213370..213768 | + | 399 | WP_000911087.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
M9379_RS24460 (M9379_24460) | 213777..213956 | - | 180 | Protein_255 | hypothetical protein | - |
M9379_RS24465 (M9379_24465) | 214001..215157 | + | 1157 | WP_258249661.1 | IS3 family transposase | - |
M9379_RS24470 (M9379_24470) | 215168..216054 | + | 887 | Protein_257 | IS630 family transposase | - |
M9379_RS24475 (M9379_24475) | 216208..217152 | - | 945 | WP_004996485.1 | lauroyl-Kdo(2)-lipid IV(A) myristoyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | ospG / ipaH9.8 / ospI / papC / icsA/virG / virA / spa40 / spa29 / spa9 / spa24 / spa33 / spa32 / spa13 / spa47 / spa15 / mxiA / mxiC / mxiD / mxiE / mxiM / mxiL / mxiN / mxiK / mxiJ / mxiI / mxiH / mxiG / ipgF / ipgE / ipgD / icsB / ipgA / ipgB1 / ipgC / ipaB / ipaC / ipaD / ipaA / ipaJ / ospC3 / ospC1 / ospD3/senA / ipaH4.5 / ipaH7.8 / ospC2 / ipaH2.5 / ospE2 / ipgB2 / ospD1 / ospF / ospD2 / ospB / icsP/sopA / nleE / ospE1 / ipaH1.4 | 1..217682 | 217682 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14799.04 Da Isoelectric Point: 8.5232
>T246338 WP_000911087.1 NZ_CP097836:213370-213768 [Shigella flexneri]
MLKFILDTNICIFTIKNKPASVRERFNLNQGKMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRTEDWS
MLKFILDTNICIFTIKNKPASVRERFNLNQGKMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRTEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|