Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 146293..147068 Replicon plasmid unnamed2
Accession NZ_CP097836
Organism Shigella flexneri strain C

Toxin (Protein)


Gene name tacT Uniprot ID Q7BEG9
Locus tag M9379_RS24030 Protein ID WP_000405245.1
Coordinates 146586..147068 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID Q7BEG8
Locus tag M9379_RS24025 Protein ID WP_010921625.1
Coordinates 146293..146595 (+) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9379_RS24000 (M9379_24000) 141635..142254 - 620 Protein_164 IS1 family transposase -
M9379_RS24005 (M9379_24005) 142658..144112 + 1455 WP_075332747.1 type 3 secretion system effector OspC2 -
M9379_RS24010 (M9379_24010) 144261..144389 - 129 Protein_166 IS5/IS1182 family transposase -
M9379_RS24020 (M9379_24020) 145749..146021 - 273 WP_258249732.1 hypothetical protein -
M9379_RS24025 (M9379_24025) 146293..146595 + 303 WP_010921625.1 DUF1778 domain-containing protein Antitoxin
M9379_RS24030 (M9379_24030) 146586..147068 + 483 WP_000405245.1 GNAT family N-acetyltransferase Toxin
M9379_RS24035 (M9379_24035) 147136..147659 + 524 Protein_171 IS3-like element ISSfl11 family transposase -
M9379_RS24040 (M9379_24040) 147702..148911 - 1210 Protein_172 IS3 family transposase -
M9379_RS24045 (M9379_24045) 148963..150654 - 1692 WP_134797093.1 IpaH family type III secretion system E3 ubiquitin--protein ligase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - ospG / ipaH9.8 / ospI / papC / icsA/virG / virA / spa40 / spa29 / spa9 / spa24 / spa33 / spa32 / spa13 / spa47 / spa15 / mxiA / mxiC / mxiD / mxiE / mxiM / mxiL / mxiN / mxiK / mxiJ / mxiI / mxiH / mxiG / ipgF / ipgE / ipgD / icsB / ipgA / ipgB1 / ipgC / ipaB / ipaC / ipaD / ipaA / ipaJ / ospC3 / ospC1 / ospD3/senA / ipaH4.5 / ipaH7.8 / ospC2 / ipaH2.5 / ospE2 / ipgB2 / ospD1 / ospF / ospD2 / ospB / icsP/sopA / nleE / ospE1 / ipaH1.4 1..217682 217682
- inside IScluster/Tn - ospC2 / ipaH2.5 / ospE2 139276..161082 21806


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(29-149)

Antitoxin

Vibrio phage ICP1, Orf50

(19-94)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17750.52 Da        Isoelectric Point: 7.0382

>T246337 WP_000405245.1 NZ_CP097836:146586-147068 [Shigella flexneri]
MEINVTAPALLTDEHILQPFDCGNEVLSNWLRGRAMKNQMLNASRTFVICLEDTLRIVGYYSLATGSVTHAELGRSLRHN
MPNPVPVVLLGRLAVDVCTQGHGFGKWLLSDAIHRVVNLADQVGIKAVMVHAIDDDARAFYERFGFVQSVVAPNTLFYKV

Download         Length: 483 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11689.28 Da        Isoelectric Point: 4.9167

>AT246337 WP_010921625.1 NZ_CP097836:146293-146595 [Shigella flexneri]
MEVFMSTAASVRKTPREHQINIRATDEERAVIDYAASLVNKNRTDFIMELAYQEAKNIILDQRLFVLDNERYDSFITQLE
APVQNAEGRERLMAVKPEWK

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q7BEG9

Antitoxin

Source ID Structure
AlphaFold DB Q7BEG8

References