246336

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/ElaA-DUF1778
Location 104456..105213 Replicon plasmid unnamed2
Accession NZ_CP097836
Organism Shigella flexneri strain C

Toxin (Protein)


Gene name tacT Uniprot ID D2AJG5
Locus tag M9379_RS23795 Protein ID WP_000501974.1
Coordinates 104728..105213 (+) Length 162 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID Q31SN8
Locus tag M9379_RS23790 Protein ID WP_011114751.1
Coordinates 104456..104740 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9379_RS23770 (M9379_23775) 100517..101191 + 675 WP_001088287.1 IS66-like element accessory protein TnpA -
M9379_RS23775 (M9379_23780) 101188..101538 + 351 WP_005048975.1 IS66 family insertion sequence element accessory protein TnpB -
M9379_RS23780 (M9379_23785) 101535..103136 + 1602 WP_005063916.1 IS66-like element ISSfl3 family transposase -
M9379_RS23785 (M9379_23790) 103390..103554 - 165 WP_001346193.1 hypothetical protein -
M9379_RS23790 (M9379_23795) 104456..104740 + 285 WP_011114751.1 DUF1778 domain-containing protein Antitoxin
M9379_RS23795 (M9379_23800) 104728..105213 + 486 WP_000501974.1 GNAT family N-acetyltransferase Toxin
M9379_RS23800 (M9379_23805) 105386..105667 - 282 Protein_124 IS4/IS5 family transposase -
M9379_RS23805 (M9379_23810) 105734..106890 + 1157 WP_134796931.1 IS3-like element IS600 family transposase -
M9379_RS23810 (M9379_23815) 107004..108232 + 1229 WP_094081542.1 IS3-like element IS2 family transposase -
M9379_RS23815 (M9379_23820) 108270..108413 + 144 Protein_127 DUF3440 domain-containing protein -
M9379_RS23820 (M9379_23825) 108398..109036 + 639 WP_000502862.1 ParB N-terminal domain-containing protein -
M9379_RS23825 (M9379_23830) 109264..109688 + 425 Protein_129 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - ospG / ipaH9.8 / ospI / papC / icsA/virG / virA / spa40 / spa29 / spa9 / spa24 / spa33 / spa32 / spa13 / spa47 / spa15 / mxiA / mxiC / mxiD / mxiE / mxiM / mxiL / mxiN / mxiK / mxiJ / mxiI / mxiH / mxiG / ipgF / ipgE / ipgD / icsB / ipgA / ipgB1 / ipgC / ipaB / ipaC / ipaD / ipaA / ipaJ / ospC3 / ospC1 / ospD3/senA / ipaH4.5 / ipaH7.8 / ospC2 / ipaH2.5 / ospE2 / ipgB2 / ospD1 / ospF / ospD2 / ospB / icsP/sopA / nleE / ospE1 / ipaH1.4 1..217682 217682
- inside IScluster/Tn - ospC3 / ospC1 / ospD3/senA / ipaH4.5 / ipaH7.8 92527..132800 40273


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(27-151)

Antitoxin

Vibrio phage ICP1, Orf50

(12-88)


Sequences

Toxin        


Download         Length: 162 a.a.        Molecular weight: 17814.63 Da        Isoelectric Point: 9.8822

>T246336 WP_000501974.1 NZ_CP097836:104728-105213 [Shigella flexneri]
MGCVTAPEPLSSFHQVAEFVSSEAVLDDWLKQKELKNQAIGATRTFVVCRKGTQQIVGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDVSFRGKGLGADLLHDAVRRCYRVAENIGVRAIMVHALTENAKQFYIHHGFKPSKTQVQTLFLKLP
Q

Download         Length: 486 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10871.52 Da        Isoelectric Point: 4.6812

>AT246336 WP_011114751.1 NZ_CP097836:104456-104740 [Shigella flexneri]
MIYGGFMKSGVQLNLRARESQRILIDAAAEILHKSRTDFILEMACKAAEDVILDRRVFNFNDRQYEEFIEMLDAPVADDP
AIEKLLARKPQWDV

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A822PN28

Antitoxin

Source ID Structure
AlphaFold DB A0A4V1CUJ1

References