Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 16057..16616 Replicon plasmid unnamed2
Accession NZ_CP097836
Organism Shigella flexneri strain C

Toxin (Protein)


Gene name relE Uniprot ID D2AJT2
Locus tag M9379_RS23275 Protein ID WP_000421262.1
Coordinates 16057..16332 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag M9379_RS23280 Protein ID WP_024260696.1
Coordinates 16332..16616 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9379_RS23250 (M9379_23255) 12933..13040 - 108 WP_023592908.1 transposase domain-containing protein -
M9379_RS23255 (M9379_23260) 13064..13369 - 306 WP_001159860.1 type II toxin-antitoxin system toxin CcdB -
M9379_RS23260 (M9379_23265) 13371..13589 - 219 WP_000813626.1 type II toxin-antitoxin system antitoxin CcdA -
M9379_RS23265 (M9379_23270) 14125..15078 - 954 Protein_17 IS66 family transposase -
M9379_RS23270 (M9379_23275) 15134..15831 + 698 WP_223368647.1 IS1 family transposase -
M9379_RS23275 (M9379_23280) 16057..16332 - 276 WP_000421262.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M9379_RS23280 (M9379_23285) 16332..16616 - 285 WP_024260696.1 ribbon-helix-helix domain-containing protein Antitoxin
M9379_RS23285 (M9379_23290) 17370..17579 + 210 Protein_21 peptidoglycan-binding protein -
M9379_RS23290 (M9379_23295) 17679..17864 - 186 Protein_22 ATP-binding protein -
M9379_RS23295 (M9379_23300) 18053..19654 - 1602 WP_134797205.1 IS66-like element ISSfl3 family transposase -
M9379_RS23300 (M9379_23305) 19651..20001 - 351 WP_005061851.1 IS66 family insertion sequence element accessory protein TnpB -
M9379_RS23305 (M9379_23310) 19998..20672 - 675 WP_004967157.1 IS66-like element accessory protein TnpA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - ospG / ipaH9.8 / ospI / papC / icsA/virG / virA / spa40 / spa29 / spa9 / spa24 / spa33 / spa32 / spa13 / spa47 / spa15 / mxiA / mxiC / mxiD / mxiE / mxiM / mxiL / mxiN / mxiK / mxiJ / mxiI / mxiH / mxiG / ipgF / ipgE / ipgD / icsB / ipgA / ipgB1 / ipgC / ipaB / ipaC / ipaD / ipaA / ipaJ / ospC3 / ospC1 / ospD3/senA / ipaH4.5 / ipaH7.8 / ospC2 / ipaH2.5 / ospE2 / ipgB2 / ospD1 / ospF / ospD2 / ospB / icsP/sopA / nleE / ospE1 / ipaH1.4 1..217682 217682
- inside IScluster/Tn - ospG / ipaH9.8 / ospI 6495..28212 21717


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10766.48 Da        Isoelectric Point: 9.9324

>T246335 WP_000421262.1 NZ_CP097836:c16332-16057 [Shigella flexneri]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFTGEYEIRYELTGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10513.93 Da        Isoelectric Point: 6.2150

>AT246335 WP_024260696.1 NZ_CP097836:c16616-16332 [Shigella flexneri]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQSW
ADSLSTDHPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A822PVM3

Antitoxin

Source ID Structure

References