Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 13064..13589 Replicon plasmid unnamed2
Accession NZ_CP097836
Organism Shigella flexneri strain C

Toxin (Protein)


Gene name ccdB Uniprot ID Q326Z8
Locus tag M9379_RS23255 Protein ID WP_001159860.1
Coordinates 13064..13369 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID Q7BEK0
Locus tag M9379_RS23260 Protein ID WP_000813626.1
Coordinates 13371..13589 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9379_RS23225 (M9379_23230) 9092..9358 - 267 Protein_9 IS66 family insertion sequence element accessory protein TnpB -
M9379_RS23230 (M9379_23235) 9715..10305 - 591 WP_000705601.1 type III secretion system effector protein kinase OspG -
M9379_RS23235 (M9379_23240) 10388..10557 - 170 Protein_11 type II toxin-antitoxin system toxin YacB -
M9379_RS23240 (M9379_23245) 10557..10826 - 270 Protein_12 type II toxin-antitoxin system antitoxin YacA -
M9379_RS23245 (M9379_23250) 11034..12671 - 1638 WP_000936806.1 T3SS effector E3 ubiquitin-protein ligase IpaH9.8 -
M9379_RS23250 (M9379_23255) 12933..13040 - 108 WP_023592908.1 transposase domain-containing protein -
M9379_RS23255 (M9379_23260) 13064..13369 - 306 WP_001159860.1 type II toxin-antitoxin system toxin CcdB Toxin
M9379_RS23260 (M9379_23265) 13371..13589 - 219 WP_000813626.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
M9379_RS23265 (M9379_23270) 14125..15078 - 954 Protein_17 IS66 family transposase -
M9379_RS23270 (M9379_23275) 15134..15831 + 698 WP_223368647.1 IS1 family transposase -
M9379_RS23275 (M9379_23280) 16057..16332 - 276 WP_000421262.1 type II toxin-antitoxin system RelE/ParE family toxin -
M9379_RS23280 (M9379_23285) 16332..16616 - 285 WP_024260696.1 ribbon-helix-helix domain-containing protein -
M9379_RS23285 (M9379_23290) 17370..17579 + 210 Protein_21 peptidoglycan-binding protein -
M9379_RS23290 (M9379_23295) 17679..17864 - 186 Protein_22 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - ospG / ipaH9.8 / ospI / papC / icsA/virG / virA / spa40 / spa29 / spa9 / spa24 / spa33 / spa32 / spa13 / spa47 / spa15 / mxiA / mxiC / mxiD / mxiE / mxiM / mxiL / mxiN / mxiK / mxiJ / mxiI / mxiH / mxiG / ipgF / ipgE / ipgD / icsB / ipgA / ipgB1 / ipgC / ipaB / ipaC / ipaD / ipaA / ipaJ / ospC3 / ospC1 / ospD3/senA / ipaH4.5 / ipaH7.8 / ospC2 / ipaH2.5 / ospE2 / ipgB2 / ospD1 / ospF / ospD2 / ospB / icsP/sopA / nleE / ospE1 / ipaH1.4 1..217682 217682
- inside IScluster/Tn - ospG / ipaH9.8 / ospI 6495..28212 21717


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11736.59 Da        Isoelectric Point: 6.4674

>T246334 WP_001159860.1 NZ_CP097836:c13369-13064 [Shigella flexneri]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPIFVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8333.36 Da        Isoelectric Point: 6.2838

>AT246334 WP_000813626.1 NZ_CP097836:c13589-13371 [Shigella flexneri]
MKQRITVTIDSDSYQLLKSANVNISGLVNTAMQKEARRLRAERWQAENQQGMAEIARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TTN3

Antitoxin

Source ID Structure
AlphaFold DB Q7BEK0

References