Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 13064..13589 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP097836 | ||
| Organism | Shigella flexneri strain C | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | Q326Z8 |
| Locus tag | M9379_RS23255 | Protein ID | WP_001159860.1 |
| Coordinates | 13064..13369 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | Q7BEK0 |
| Locus tag | M9379_RS23260 | Protein ID | WP_000813626.1 |
| Coordinates | 13371..13589 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9379_RS23225 (M9379_23230) | 9092..9358 | - | 267 | Protein_9 | IS66 family insertion sequence element accessory protein TnpB | - |
| M9379_RS23230 (M9379_23235) | 9715..10305 | - | 591 | WP_000705601.1 | type III secretion system effector protein kinase OspG | - |
| M9379_RS23235 (M9379_23240) | 10388..10557 | - | 170 | Protein_11 | type II toxin-antitoxin system toxin YacB | - |
| M9379_RS23240 (M9379_23245) | 10557..10826 | - | 270 | Protein_12 | type II toxin-antitoxin system antitoxin YacA | - |
| M9379_RS23245 (M9379_23250) | 11034..12671 | - | 1638 | WP_000936806.1 | T3SS effector E3 ubiquitin-protein ligase IpaH9.8 | - |
| M9379_RS23250 (M9379_23255) | 12933..13040 | - | 108 | WP_023592908.1 | transposase domain-containing protein | - |
| M9379_RS23255 (M9379_23260) | 13064..13369 | - | 306 | WP_001159860.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| M9379_RS23260 (M9379_23265) | 13371..13589 | - | 219 | WP_000813626.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| M9379_RS23265 (M9379_23270) | 14125..15078 | - | 954 | Protein_17 | IS66 family transposase | - |
| M9379_RS23270 (M9379_23275) | 15134..15831 | + | 698 | WP_223368647.1 | IS1 family transposase | - |
| M9379_RS23275 (M9379_23280) | 16057..16332 | - | 276 | WP_000421262.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| M9379_RS23280 (M9379_23285) | 16332..16616 | - | 285 | WP_024260696.1 | ribbon-helix-helix domain-containing protein | - |
| M9379_RS23285 (M9379_23290) | 17370..17579 | + | 210 | Protein_21 | peptidoglycan-binding protein | - |
| M9379_RS23290 (M9379_23295) | 17679..17864 | - | 186 | Protein_22 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | ospG / ipaH9.8 / ospI / papC / icsA/virG / virA / spa40 / spa29 / spa9 / spa24 / spa33 / spa32 / spa13 / spa47 / spa15 / mxiA / mxiC / mxiD / mxiE / mxiM / mxiL / mxiN / mxiK / mxiJ / mxiI / mxiH / mxiG / ipgF / ipgE / ipgD / icsB / ipgA / ipgB1 / ipgC / ipaB / ipaC / ipaD / ipaA / ipaJ / ospC3 / ospC1 / ospD3/senA / ipaH4.5 / ipaH7.8 / ospC2 / ipaH2.5 / ospE2 / ipgB2 / ospD1 / ospF / ospD2 / ospB / icsP/sopA / nleE / ospE1 / ipaH1.4 | 1..217682 | 217682 | |
| - | inside | IScluster/Tn | - | ospG / ipaH9.8 / ospI | 6495..28212 | 21717 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11736.59 Da Isoelectric Point: 6.4674
>T246334 WP_001159860.1 NZ_CP097836:c13369-13064 [Shigella flexneri]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPIFVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPIFVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TTN3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q7BEK0 |