Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4270379..4271033 | Replicon | chromosome |
Accession | NZ_CP097834 | ||
Organism | Shigella flexneri strain C |
Toxin (Protein)
Gene name | cptA | Uniprot ID | Q0T101 |
Locus tag | M9379_RS21570 | Protein ID | WP_000244767.1 |
Coordinates | 4270626..4271033 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | Q0T100 |
Locus tag | M9379_RS21565 | Protein ID | WP_000354044.1 |
Coordinates | 4270379..4270645 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9379_RS21540 (4265550) | 4265550..4266292 | + | 743 | Protein_4193 | SDR family oxidoreductase | - |
M9379_RS21545 (4266349) | 4266349..4267782 | - | 1434 | WP_005076748.1 | 6-phospho-beta-glucosidase BglA | - |
M9379_RS21550 (4267827) | 4267827..4268137 | + | 311 | Protein_4195 | N(4)-acetylcytidine aminohydrolase | - |
M9379_RS21555 (4268301) | 4268301..4268960 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
M9379_RS21560 (4269156) | 4269156..4270136 | - | 981 | WP_000886065.1 | tRNA-modifying protein YgfZ | - |
M9379_RS21565 (4270379) | 4270379..4270645 | + | 267 | WP_000354044.1 | FAD assembly factor SdhE | Antitoxin |
M9379_RS21570 (4270626) | 4270626..4271033 | + | 408 | WP_000244767.1 | protein YgfX | Toxin |
M9379_RS21575 (4271073) | 4271073..4271594 | - | 522 | WP_001055867.1 | flavodoxin FldB | - |
M9379_RS21580 (4271706) | 4271706..4272602 | + | 897 | WP_000806987.1 | site-specific tyrosine recombinase XerD | - |
M9379_RS21585 (4272627) | 4272627..4273337 | + | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
M9379_RS21590 (4273343) | 4273343..4275076 | + | 1734 | WP_000813187.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15978.91 Da Isoelectric Point: 10.9373
>T246333 WP_000244767.1 NZ_CP097834:4270626-4271033 [Shigella flexneri]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRCINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRCINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TIU0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TIU2 |