Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 36948..37507 Replicon plasmid unnamed2
Accession NZ_CP097832
Organism Shigella flexneri strain D

Toxin (Protein)


Gene name relE Uniprot ID D2AJT2
Locus tag M9381_RS22995 Protein ID WP_000421262.1
Coordinates 36948..37223 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag M9381_RS23000 Protein ID WP_024260696.1
Coordinates 37223..37507 (-) Length 95 a.a.

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9381_RS22970 (M9381_22975) 33824..33931 - 108 WP_023592908.1 transposase domain-containing protein -
M9381_RS22975 (M9381_22980) 33955..34260 - 306 WP_001159860.1 type II toxin-antitoxin system toxin CcdB -
M9381_RS22980 (M9381_22985) 34262..34480 - 219 WP_000813626.1 type II toxin-antitoxin system antitoxin CcdA -
M9381_RS22985 (M9381_22990) 35016..35969 - 954 Protein_39 IS66 family transposase -
M9381_RS22990 (M9381_22995) 36025..36722 + 698 WP_223368647.1 IS1 family transposase -
M9381_RS22995 (M9381_23000) 36948..37223 - 276 WP_000421262.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M9381_RS23000 (M9381_23005) 37223..37507 - 285 WP_024260696.1 ribbon-helix-helix domain-containing protein Antitoxin
M9381_RS23005 (M9381_23010) 37959..38210 + 252 WP_001381727.1 transporter -
M9381_RS23010 (M9381_23015) 38260..38469 + 210 Protein_44 peptidoglycan-binding protein -
M9381_RS23015 (M9381_23020) 38569..38754 - 186 Protein_45 ATP-binding protein -
M9381_RS23020 (M9381_23025) 38943..40544 - 1602 WP_134797205.1 IS66-like element ISSfl3 family transposase -
M9381_RS23025 (M9381_23030) 40541..40891 - 351 WP_005061851.1 IS66 family insertion sequence element accessory protein TnpB -
M9381_RS23030 (M9381_23035) 40888..41562 - 675 WP_004967157.1 IS66-like element accessory protein TnpA -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - ipaH1.4 / ospG / ipaH9.8 / ospI / papC / icsA/virG / virA / spa40 / spa29 / spa9 / spa24 / spa33 / spa32 / spa13 / spa47 / spa15 / mxiA / mxiC / mxiD / mxiE / mxiM / mxiL / mxiN / mxiK / mxiJ / mxiI / mxiH / mxiG / ipgF / ipgE / ipgD / icsB / icsB / ipgA / ipgB1 / ipgC / ipaB / ipaC / ipaD / ipaA / ipaJ / ospC3 / ospC1 / ospD3/senA / ipaH4.5 / ipaH7.8 / ospC2 / ipaH2.5 / ospE2 / ipgB2 / ospD1 / ospF / ospD2 / ospB / icsP/sopA / nleE / ospE1 1..217681 217681
- inside IScluster/Tn - ospG / ipaH9.8 / ospI 27132..49102 21970


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.



Sequences


Toxin        


Download         Length: 92 a.a.        Molecular weight: 10766.48 Da        Isoelectric Point: 9.9324

>T246316 WP_000421262.1 NZ_CP097832:c37223-36948 [Shigella flexneri]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFTGEYEIRYELTGQTIY
VLRLWHTRENR

Download         Length: 276 bp


Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10513.93 Da        Isoelectric Point: 6.2150

>AT246316 WP_024260696.1 NZ_CP097832:c37507-37223 [Shigella flexneri]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQSW
ADSLSTDHPLPVPR

Download         Length: 285 bp


Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A822PVM3


Antitoxin

Source ID Structure

References