Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 33955..34480 Replicon plasmid unnamed2
Accession NZ_CP097832
Organism Shigella flexneri strain D

Toxin (Protein)


Gene name ccdB Uniprot ID Q326Z8
Locus tag M9381_RS22975 Protein ID WP_001159860.1
Coordinates 33955..34260 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID Q7BEK0
Locus tag M9381_RS22980 Protein ID WP_000813626.1
Coordinates 34262..34480 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9381_RS22945 (M9381_22950) 29983..30249 - 267 Protein_31 IS66 family insertion sequence element accessory protein TnpB -
M9381_RS22950 (M9381_22955) 30606..31196 - 591 WP_000705601.1 type III secretion system effector protein kinase OspG -
M9381_RS22955 (M9381_22960) 31279..31448 - 170 Protein_33 type II toxin-antitoxin system toxin YacB -
M9381_RS22960 (M9381_22965) 31448..31717 - 270 Protein_34 type II toxin-antitoxin system antitoxin YacA -
M9381_RS22965 (M9381_22970) 31925..33562 - 1638 WP_000936806.1 T3SS effector E3 ubiquitin-protein ligase IpaH9.8 -
M9381_RS22970 (M9381_22975) 33824..33931 - 108 WP_023592908.1 transposase domain-containing protein -
M9381_RS22975 (M9381_22980) 33955..34260 - 306 WP_001159860.1 type II toxin-antitoxin system toxin CcdB Toxin
M9381_RS22980 (M9381_22985) 34262..34480 - 219 WP_000813626.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
M9381_RS22985 (M9381_22990) 35016..35969 - 954 Protein_39 IS66 family transposase -
M9381_RS22990 (M9381_22995) 36025..36722 + 698 WP_223368647.1 IS1 family transposase -
M9381_RS22995 (M9381_23000) 36948..37223 - 276 WP_000421262.1 type II toxin-antitoxin system RelE/ParE family toxin -
M9381_RS23000 (M9381_23005) 37223..37507 - 285 WP_024260696.1 ribbon-helix-helix domain-containing protein -
M9381_RS23005 (M9381_23010) 37959..38210 + 252 WP_001381727.1 transporter -
M9381_RS23010 (M9381_23015) 38260..38469 + 210 Protein_44 peptidoglycan-binding protein -
M9381_RS23015 (M9381_23020) 38569..38754 - 186 Protein_45 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - ipaH1.4 / ospG / ipaH9.8 / ospI / papC / icsA/virG / virA / spa40 / spa29 / spa9 / spa24 / spa33 / spa32 / spa13 / spa47 / spa15 / mxiA / mxiC / mxiD / mxiE / mxiM / mxiL / mxiN / mxiK / mxiJ / mxiI / mxiH / mxiG / ipgF / ipgE / ipgD / icsB / icsB / ipgA / ipgB1 / ipgC / ipaB / ipaC / ipaD / ipaA / ipaJ / ospC3 / ospC1 / ospD3/senA / ipaH4.5 / ipaH7.8 / ospC2 / ipaH2.5 / ospE2 / ipgB2 / ospD1 / ospF / ospD2 / ospB / icsP/sopA / nleE / ospE1 1..217681 217681
- inside IScluster/Tn - ospG / ipaH9.8 / ospI 27132..49102 21970


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11736.59 Da        Isoelectric Point: 6.4674

>T246315 WP_001159860.1 NZ_CP097832:c34260-33955 [Shigella flexneri]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPIFVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8333.36 Da        Isoelectric Point: 6.2838

>AT246315 WP_000813626.1 NZ_CP097832:c34480-34262 [Shigella flexneri]
MKQRITVTIDSDSYQLLKSANVNISGLVNTAMQKEARRLRAERWQAENQQGMAEIARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TTN3

Antitoxin

Source ID Structure
AlphaFold DB Q7BEK0

References