Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1797442..1798096 | Replicon | chromosome |
| Accession | NZ_CP097831 | ||
| Organism | Shigella flexneri strain D | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | Q0T101 |
| Locus tag | M9381_RS08735 | Protein ID | WP_000244767.1 |
| Coordinates | 1797689..1798096 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | Q0T100 |
| Locus tag | M9381_RS08730 | Protein ID | WP_000354044.1 |
| Coordinates | 1797442..1797708 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9381_RS08705 (1792613) | 1792613..1793355 | + | 743 | Protein_1691 | SDR family oxidoreductase | - |
| M9381_RS08710 (1793412) | 1793412..1794845 | - | 1434 | WP_005076748.1 | 6-phospho-beta-glucosidase BglA | - |
| M9381_RS08715 (1794890) | 1794890..1795200 | + | 311 | Protein_1693 | N(4)-acetylcytidine aminohydrolase | - |
| M9381_RS08720 (1795364) | 1795364..1796023 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| M9381_RS08725 (1796219) | 1796219..1797199 | - | 981 | WP_000886065.1 | tRNA-modifying protein YgfZ | - |
| M9381_RS08730 (1797442) | 1797442..1797708 | + | 267 | WP_000354044.1 | FAD assembly factor SdhE | Antitoxin |
| M9381_RS08735 (1797689) | 1797689..1798096 | + | 408 | WP_000244767.1 | protein YgfX | Toxin |
| M9381_RS08740 (1798136) | 1798136..1798657 | - | 522 | WP_001055867.1 | flavodoxin FldB | - |
| M9381_RS08745 (1798769) | 1798769..1799665 | + | 897 | WP_000806987.1 | site-specific tyrosine recombinase XerD | - |
| M9381_RS08750 (1799690) | 1799690..1800400 | + | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M9381_RS08755 (1800406) | 1800406..1802139 | + | 1734 | WP_000813187.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15978.91 Da Isoelectric Point: 10.9373
>T246302 WP_000244767.1 NZ_CP097831:1797689-1798096 [Shigella flexneri]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRCINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRCINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TIU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TIU2 |