Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 151556..152115 Replicon plasmid unnamed1
Accession NZ_CP097829
Organism Shigella flexneri strain E

Toxin (Protein)


Gene name relE Uniprot ID D2AJT2
Locus tag M9383_RS23690 Protein ID WP_000421262.1
Coordinates 151556..151831 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag M9383_RS23695 Protein ID WP_024260696.1
Coordinates 151831..152115 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9383_RS23665 (M9383_23665) 148432..148539 - 108 WP_023592908.1 transposase domain-containing protein -
M9383_RS23670 (M9383_23670) 148563..148868 - 306 WP_001159860.1 type II toxin-antitoxin system toxin CcdB -
M9383_RS23675 (M9383_23675) 148870..149088 - 219 WP_000813626.1 type II toxin-antitoxin system antitoxin CcdA -
M9383_RS23680 (M9383_23680) 149624..150577 - 954 Protein_175 IS66 family transposase -
M9383_RS23685 (M9383_23685) 150633..151330 + 698 WP_223368647.1 IS1 family transposase -
M9383_RS23690 (M9383_23690) 151556..151831 - 276 WP_000421262.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M9383_RS23695 (M9383_23695) 151831..152115 - 285 WP_024260696.1 ribbon-helix-helix domain-containing protein Antitoxin
M9383_RS23700 (M9383_23700) 152567..152818 + 252 WP_001381727.1 transporter -
M9383_RS23705 (M9383_23705) 152868..153077 + 210 Protein_180 peptidoglycan-binding protein -
M9383_RS23710 (M9383_23710) 153177..153362 - 186 Protein_181 ATP-binding protein -
M9383_RS23715 (M9383_23715) 153551..155152 - 1602 WP_134797205.1 IS66-like element ISSfl3 family transposase -
M9383_RS23720 (M9383_23720) 155149..155499 - 351 WP_005061851.1 IS66 family insertion sequence element accessory protein TnpB -
M9383_RS23725 (M9383_23725) 155496..156170 - 675 WP_004967157.1 IS66-like element accessory protein TnpA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - ipaB / ipaB / ipaC / ipaD / ipaA / ipaJ / ospC3 / ospC1 / ospD3/senA / ipaH4.5 / ipaH7.8 / ospC2 / ipaH2.5 / ospE2 / ipgB2 / ospD1 / ospF / ospD2 / ospB / icsP/sopA / nleE / ospE1 / ipaH1.4 / ospG / ipaH9.8 / ospI / papC / icsA/virG / virA / spa40 / spa29 / spa9 / spa24 / spa33 / spa32 / spa13 / spa47 / spa15 / mxiA / mxiC / mxiD / mxiE / mxiM / mxiL / mxiN / mxiK / mxiJ / mxiI / mxiH / mxiG / ipgF / ipgE / ipgD / icsB / ipgA / ipgB1 1..217681 217681
- inside IScluster/Tn - ospG / ipaH9.8 / ospI 141740..163710 21970


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10766.48 Da        Isoelectric Point: 9.9324

>T246298 WP_000421262.1 NZ_CP097829:c151831-151556 [Shigella flexneri]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFTGEYEIRYELTGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10513.93 Da        Isoelectric Point: 6.2150

>AT246298 WP_024260696.1 NZ_CP097829:c152115-151831 [Shigella flexneri]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQSW
ADSLSTDHPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A822PVM3

Antitoxin

Source ID Structure

References