Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 148563..149088 Replicon plasmid unnamed1
Accession NZ_CP097829
Organism Shigella flexneri strain E

Toxin (Protein)


Gene name ccdB Uniprot ID Q326Z8
Locus tag M9383_RS23670 Protein ID WP_001159860.1
Coordinates 148563..148868 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID Q7BEK0
Locus tag M9383_RS23675 Protein ID WP_000813626.1
Coordinates 148870..149088 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9383_RS23640 (M9383_23640) 144591..144857 - 267 Protein_167 IS66 family insertion sequence element accessory protein TnpB -
M9383_RS23645 (M9383_23645) 145214..145804 - 591 WP_000705601.1 type III secretion system effector protein kinase OspG -
M9383_RS23650 (M9383_23650) 145887..146056 - 170 Protein_169 type II toxin-antitoxin system toxin YacB -
M9383_RS23655 (M9383_23655) 146056..146325 - 270 Protein_170 type II toxin-antitoxin system antitoxin YacA -
M9383_RS23660 (M9383_23660) 146533..148170 - 1638 WP_000936806.1 T3SS effector E3 ubiquitin-protein ligase IpaH9.8 -
M9383_RS23665 (M9383_23665) 148432..148539 - 108 WP_023592908.1 transposase domain-containing protein -
M9383_RS23670 (M9383_23670) 148563..148868 - 306 WP_001159860.1 type II toxin-antitoxin system toxin CcdB Toxin
M9383_RS23675 (M9383_23675) 148870..149088 - 219 WP_000813626.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
M9383_RS23680 (M9383_23680) 149624..150577 - 954 Protein_175 IS66 family transposase -
M9383_RS23685 (M9383_23685) 150633..151330 + 698 WP_223368647.1 IS1 family transposase -
M9383_RS23690 (M9383_23690) 151556..151831 - 276 WP_000421262.1 type II toxin-antitoxin system RelE/ParE family toxin -
M9383_RS23695 (M9383_23695) 151831..152115 - 285 WP_024260696.1 ribbon-helix-helix domain-containing protein -
M9383_RS23700 (M9383_23700) 152567..152818 + 252 WP_001381727.1 transporter -
M9383_RS23705 (M9383_23705) 152868..153077 + 210 Protein_180 peptidoglycan-binding protein -
M9383_RS23710 (M9383_23710) 153177..153362 - 186 Protein_181 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - ipaB / ipaB / ipaC / ipaD / ipaA / ipaJ / ospC3 / ospC1 / ospD3/senA / ipaH4.5 / ipaH7.8 / ospC2 / ipaH2.5 / ospE2 / ipgB2 / ospD1 / ospF / ospD2 / ospB / icsP/sopA / nleE / ospE1 / ipaH1.4 / ospG / ipaH9.8 / ospI / papC / icsA/virG / virA / spa40 / spa29 / spa9 / spa24 / spa33 / spa32 / spa13 / spa47 / spa15 / mxiA / mxiC / mxiD / mxiE / mxiM / mxiL / mxiN / mxiK / mxiJ / mxiI / mxiH / mxiG / ipgF / ipgE / ipgD / icsB / ipgA / ipgB1 1..217681 217681
- inside IScluster/Tn - ospG / ipaH9.8 / ospI 141740..163710 21970


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11736.59 Da        Isoelectric Point: 6.4674

>T246297 WP_001159860.1 NZ_CP097829:c148868-148563 [Shigella flexneri]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPIFVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8333.36 Da        Isoelectric Point: 6.2838

>AT246297 WP_000813626.1 NZ_CP097829:c149088-148870 [Shigella flexneri]
MKQRITVTIDSDSYQLLKSANVNISGLVNTAMQKEARRLRAERWQAENQQGMAEIARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TTN3

Antitoxin

Source ID Structure
AlphaFold DB Q7BEK0

References