Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 64111..64886 Replicon plasmid unnamed1
Accession NZ_CP097829
Organism Shigella flexneri strain E

Toxin (Protein)


Gene name tacT Uniprot ID Q7BEG9
Locus tag M9383_RS23140 Protein ID WP_000405245.1
Coordinates 64404..64886 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID Q7BEG8
Locus tag M9383_RS23135 Protein ID WP_010921625.1
Coordinates 64111..64413 (+) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9383_RS23110 (M9383_23115) 59453..60072 - 620 Protein_62 IS1 family transposase -
M9383_RS23115 (M9383_23120) 60476..61930 + 1455 WP_075332747.1 type 3 secretion system effector OspC2 -
M9383_RS23120 (M9383_23125) 62079..62207 - 129 Protein_64 IS5/IS1182 family transposase -
M9383_RS23130 (M9383_23135) 63567..63839 - 273 WP_258249732.1 hypothetical protein -
M9383_RS23135 (M9383_23140) 64111..64413 + 303 WP_010921625.1 DUF1778 domain-containing protein Antitoxin
M9383_RS23140 (M9383_23145) 64404..64886 + 483 WP_000405245.1 GNAT family N-acetyltransferase Toxin
M9383_RS23145 (M9383_23150) 64954..65477 + 524 Protein_69 IS3-like element ISSfl11 family transposase -
M9383_RS23150 (M9383_23155) 65520..66729 - 1210 Protein_70 IS3 family transposase -
M9383_RS23155 (M9383_23160) 66781..68472 - 1692 WP_134797093.1 IpaH family type III secretion system E3 ubiquitin--protein ligase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - ipaB / ipaB / ipaC / ipaD / ipaA / ipaJ / ospC3 / ospC1 / ospD3/senA / ipaH4.5 / ipaH7.8 / ospC2 / ipaH2.5 / ospE2 / ipgB2 / ospD1 / ospF / ospD2 / ospB / icsP/sopA / nleE / ospE1 / ipaH1.4 / ospG / ipaH9.8 / ospI / papC / icsA/virG / virA / spa40 / spa29 / spa9 / spa24 / spa33 / spa32 / spa13 / spa47 / spa15 / mxiA / mxiC / mxiD / mxiE / mxiM / mxiL / mxiN / mxiK / mxiJ / mxiI / mxiH / mxiG / ipgF / ipgE / ipgD / icsB / ipgA / ipgB1 1..217681 217681
- inside IScluster/Tn - ospC2 / ipaH2.5 / ospE2 57094..78900 21806


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(29-149)

Antitoxin

Vibrio phage ICP1, Orf50

(19-94)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17750.52 Da        Isoelectric Point: 7.0382

>T246295 WP_000405245.1 NZ_CP097829:64404-64886 [Shigella flexneri]
MEINVTAPALLTDEHILQPFDCGNEVLSNWLRGRAMKNQMLNASRTFVICLEDTLRIVGYYSLATGSVTHAELGRSLRHN
MPNPVPVVLLGRLAVDVCTQGHGFGKWLLSDAIHRVVNLADQVGIKAVMVHAIDDDARAFYERFGFVQSVVAPNTLFYKV

Download         Length: 483 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11689.28 Da        Isoelectric Point: 4.9167

>AT246295 WP_010921625.1 NZ_CP097829:64111-64413 [Shigella flexneri]
MEVFMSTAASVRKTPREHQINIRATDEERAVIDYAASLVNKNRTDFIMELAYQEAKNIILDQRLFVLDNERYDSFITQLE
APVQNAEGRERLMAVKPEWK

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q7BEG9

Antitoxin

Source ID Structure
AlphaFold DB Q7BEG8

References