Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/ElaA-DUF1778 |
| Location | 22274..23031 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP097829 | ||
| Organism | Shigella flexneri strain E | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | D2AJG5 |
| Locus tag | M9383_RS22905 | Protein ID | WP_000501974.1 |
| Coordinates | 22546..23031 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | Q31SN8 |
| Locus tag | M9383_RS22900 | Protein ID | WP_011114751.1 |
| Coordinates | 22274..22558 (+) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9383_RS22880 (M9383_22890) | 18335..19009 | + | 675 | WP_001088287.1 | IS66-like element accessory protein TnpA | - |
| M9383_RS22885 (M9383_22895) | 19006..19356 | + | 351 | WP_005048975.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| M9383_RS22890 (M9383_22900) | 19353..20954 | + | 1602 | WP_005063916.1 | IS66-like element ISSfl3 family transposase | - |
| M9383_RS22895 (M9383_22905) | 21208..21372 | - | 165 | WP_001346193.1 | hypothetical protein | - |
| M9383_RS22900 (M9383_22910) | 22274..22558 | + | 285 | WP_011114751.1 | DUF1778 domain-containing protein | Antitoxin |
| M9383_RS22905 (M9383_22915) | 22546..23031 | + | 486 | WP_000501974.1 | GNAT family N-acetyltransferase | Toxin |
| M9383_RS22910 (M9383_22920) | 23204..23485 | - | 282 | Protein_22 | IS4/IS5 family transposase | - |
| M9383_RS22915 (M9383_22925) | 23552..24708 | + | 1157 | WP_134796931.1 | IS3-like element IS600 family transposase | - |
| M9383_RS22920 (M9383_22930) | 24822..26050 | + | 1229 | WP_094081542.1 | IS3-like element IS2 family transposase | - |
| M9383_RS22925 (M9383_22935) | 26088..26231 | + | 144 | Protein_25 | DUF3440 domain-containing protein | - |
| M9383_RS22930 (M9383_22940) | 26216..26854 | + | 639 | WP_000502862.1 | ParB N-terminal domain-containing protein | - |
| M9383_RS22935 (M9383_22945) | 27082..27506 | + | 425 | Protein_27 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | ipaB / ipaB / ipaC / ipaD / ipaA / ipaJ / ospC3 / ospC1 / ospD3/senA / ipaH4.5 / ipaH7.8 / ospC2 / ipaH2.5 / ospE2 / ipgB2 / ospD1 / ospF / ospD2 / ospB / icsP/sopA / nleE / ospE1 / ipaH1.4 / ospG / ipaH9.8 / ospI / papC / icsA/virG / virA / spa40 / spa29 / spa9 / spa24 / spa33 / spa32 / spa13 / spa47 / spa15 / mxiA / mxiC / mxiD / mxiE / mxiM / mxiL / mxiN / mxiK / mxiJ / mxiI / mxiH / mxiG / ipgF / ipgE / ipgD / icsB / ipgA / ipgB1 | 1..217681 | 217681 | |
| - | inside | IScluster/Tn | - | ospC3 / ospC1 / ospD3/senA / ipaH4.5 / ipaH7.8 | 10345..50618 | 40273 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17814.63 Da Isoelectric Point: 9.8822
>T246294 WP_000501974.1 NZ_CP097829:22546-23031 [Shigella flexneri]
MGCVTAPEPLSSFHQVAEFVSSEAVLDDWLKQKELKNQAIGATRTFVVCRKGTQQIVGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDVSFRGKGLGADLLHDAVRRCYRVAENIGVRAIMVHALTENAKQFYIHHGFKPSKTQVQTLFLKLP
Q
MGCVTAPEPLSSFHQVAEFVSSEAVLDDWLKQKELKNQAIGATRTFVVCRKGTQQIVGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDVSFRGKGLGADLLHDAVRRCYRVAENIGVRAIMVHALTENAKQFYIHHGFKPSKTQVQTLFLKLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A822PN28 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4V1CUJ1 |