Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4176829..4177355 | Replicon | chromosome |
| Accession | NZ_CP097828 | ||
| Organism | Shigella flexneri strain E | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | M9383_RS21030 | Protein ID | WP_000323025.1 |
| Coordinates | 4177068..4177355 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | M9383_RS21025 | Protein ID | WP_000534858.1 |
| Coordinates | 4176829..4177068 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9383_RS21005 (4174424) | 4174424..4174852 | - | 429 | Protein_4081 | fimbrial protein | - |
| M9383_RS21010 (4174909) | 4174909..4175606 | + | 698 | WP_232046037.1 | IS1 family transposase | - |
| M9383_RS21015 (4175624) | 4175624..4176502 | + | 879 | Protein_4083 | IS3-like element IS600 family transposase | - |
| M9383_RS21020 (4176499) | 4176499..4176804 | - | 306 | WP_071818640.1 | hypothetical protein | - |
| M9383_RS21025 (4176829) | 4176829..4177068 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| M9383_RS21030 (4177068) | 4177068..4177355 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| M9383_RS21035 (4177427) | 4177427..4177582 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| M9383_RS21040 (4177800) | 4177800..4178015 | + | 216 | WP_000980986.1 | hypothetical protein | - |
| M9383_RS21045 (4178118) | 4178118..4178396 | + | 279 | Protein_4089 | hypothetical protein | - |
| M9383_RS21050 (4178398) | 4178398..4179447 | + | 1050 | WP_001265249.1 | DUF968 domain-containing protein | - |
| M9383_RS21055 (4179460) | 4179460..4179816 | + | 357 | WP_000904111.1 | RusA family crossover junction endodeoxyribonuclease | - |
| M9383_RS21060 (4179831) | 4179831..4180652 | + | 822 | WP_000762884.1 | antitermination protein | - |
| M9383_RS21075 (4181573) | 4181573..4181681 | + | 109 | Protein_4093 | DUF3927 family protein | - |
| M9383_RS21080 (4181962) | 4181962..4182297 | - | 336 | WP_000871291.1 | anti-adapter protein IraM | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 4171811..4193448 | 21637 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T246289 WP_000323025.1 NZ_CP097828:4177068-4177355 [Shigella flexneri]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|