Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1074738..1075392 | Replicon | chromosome |
Accession | NZ_CP097828 | ||
Organism | Shigella flexneri strain E |
Toxin (Protein)
Gene name | cptA | Uniprot ID | Q0T101 |
Locus tag | M9383_RS05415 | Protein ID | WP_000244767.1 |
Coordinates | 1074738..1075145 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | Q0T100 |
Locus tag | M9383_RS05420 | Protein ID | WP_000354044.1 |
Coordinates | 1075126..1075392 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9383_RS05395 (1070695) | 1070695..1072428 | - | 1734 | WP_000813187.1 | single-stranded-DNA-specific exonuclease RecJ | - |
M9383_RS05400 (1072434) | 1072434..1073144 | - | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
M9383_RS05405 (1073169) | 1073169..1074065 | - | 897 | WP_000806987.1 | site-specific tyrosine recombinase XerD | - |
M9383_RS05410 (1074177) | 1074177..1074698 | + | 522 | WP_001055867.1 | flavodoxin FldB | - |
M9383_RS05415 (1074738) | 1074738..1075145 | - | 408 | WP_000244767.1 | protein YgfX | Toxin |
M9383_RS05420 (1075126) | 1075126..1075392 | - | 267 | WP_000354044.1 | FAD assembly factor SdhE | Antitoxin |
M9383_RS05425 (1075635) | 1075635..1076615 | + | 981 | WP_000886065.1 | tRNA-modifying protein YgfZ | - |
M9383_RS05430 (1076811) | 1076811..1077470 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
M9383_RS05435 (1077634) | 1077634..1077944 | - | 311 | Protein_1049 | N(4)-acetylcytidine aminohydrolase | - |
M9383_RS05440 (1077989) | 1077989..1079422 | + | 1434 | WP_005076748.1 | 6-phospho-beta-glucosidase BglA | - |
M9383_RS05445 (1079479) | 1079479..1080221 | - | 743 | Protein_1051 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15978.91 Da Isoelectric Point: 10.9373
>T246278 WP_000244767.1 NZ_CP097828:c1075145-1074738 [Shigella flexneri]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRCINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRCINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TIU0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TIU2 |