Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2671659..2672254 | Replicon | chromosome |
| Accession | NZ_CP097810 | ||
| Organism | Clostridium sp. MD294 strain ASF356 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | N1Z577 |
| Locus tag | C820_RS13220 | Protein ID | WP_004036915.1 |
| Coordinates | 2671659..2671835 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | N1Z8W1 |
| Locus tag | C820_RS13225 | Protein ID | WP_004036914.1 |
| Coordinates | 2671871..2672254 (+) | Length | 128 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C820_RS13185 (C820_002615) | 2667213..2667893 | - | 681 | WP_004036919.1 | N-acetylmuramoyl-L-alanine amidase | - |
| C820_RS13190 (C820_002616) | 2667898..2668761 | - | 864 | WP_004036918.1 | DNA cytosine methyltransferase | - |
| C820_RS13195 (C820_002617) | 2668817..2669080 | - | 264 | WP_004036917.1 | phage holin | - |
| C820_RS13200 (C820_002618) | 2669082..2669336 | - | 255 | WP_004034586.1 | hypothetical protein | - |
| C820_RS13205 (C820_002619) | 2669437..2669589 | - | 153 | WP_004034587.1 | XkdX family protein | - |
| C820_RS13210 (C820_002620) | 2669582..2669770 | - | 189 | WP_004034588.1 | hypothetical protein | - |
| C820_RS13215 (C820_002621) | 2669767..2671536 | - | 1770 | WP_004036916.1 | fibronectin type III domain-containing protein | - |
| C820_RS13220 (C820_002622) | 2671659..2671835 | + | 177 | WP_004036915.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| C820_RS13225 (C820_002623) | 2671871..2672254 | + | 384 | WP_004036914.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| C820_RS13230 (C820_002624) | 2672279..2673040 | - | 762 | WP_251855596.1 | phage tail protein | - |
| C820_RS13235 (C820_002625) | 2673053..2676346 | - | 3294 | WP_162213073.1 | peptidase G2 autoproteolytic cleavage domain-containing protein | - |
| C820_RS13240 (C820_002626) | 2676546..2677202 | - | 657 | WP_004036911.1 | DUF2313 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2661083..2727356 | 66273 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6653.05 Da Isoelectric Point: 11.0265
>T246276 WP_004036915.1 NZ_CP097810:2671659-2671835 [Clostridium sp. MD294]
MRDKDLLKLLKKNGWVVKRVRGSHHVMQKGDKIQIVAVHNKDVPIGLLEKILKETGLK
MRDKDLLKLLKKNGWVVKRVRGSHHVMQKGDKIQIVAVHNKDVPIGLLEKILKETGLK
Download Length: 177 bp
Antitoxin
Download Length: 128 a.a. Molecular weight: 14401.37 Da Isoelectric Point: 4.3431
>AT246276 WP_004036914.1 NZ_CP097810:2671871-2672254 [Clostridium sp. MD294]
MLFIYPAIFHKENNSYWVEFPDLEGCQTYGDTLNETMEYAQEALAAYLLTLLEQNLTLAQPSDISSISHSSDSFATLVTC
DINQYKDTKAVKKTLTIPAWLNERALAMNINFSQVLQEALLTKIQTK
MLFIYPAIFHKENNSYWVEFPDLEGCQTYGDTLNETMEYAQEALAAYLLTLLEQNLTLAQPSDISSISHSSDSFATLVTC
DINQYKDTKAVKKTLTIPAWLNERALAMNINFSQVLQEALLTKIQTK
Download Length: 384 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|