Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 4730857..4731433 | Replicon | chromosome |
Accession | NZ_CP097808 | ||
Organism | Klebsiella variicola strain 17YN56 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | - |
Locus tag | M9O80_RS22970 | Protein ID | WP_012542979.1 |
Coordinates | 4731146..4731433 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | - |
Locus tag | M9O80_RS22965 | Protein ID | WP_022065028.1 |
Coordinates | 4730857..4731159 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O80_RS22940 (M9O80_22940) | 4726265..4727329 | - | 1065 | WP_008807596.1 | DUF2955 domain-containing protein | - |
M9O80_RS22945 (M9O80_22945) | 4727319..4728386 | - | 1068 | WP_022065029.1 | HlyD family secretion protein | - |
M9O80_RS22950 (M9O80_22950) | 4728393..4728857 | - | 465 | WP_008807598.1 | MarR family transcriptional regulator | - |
M9O80_RS22955 (M9O80_22955) | 4729023..4729187 | - | 165 | WP_008807599.1 | DUF1127 domain-containing protein | - |
M9O80_RS22960 (M9O80_22960) | 4729365..4730777 | + | 1413 | WP_008807600.1 | PLP-dependent aminotransferase family protein | - |
M9O80_RS22965 (M9O80_22965) | 4730857..4731159 | - | 303 | WP_022065028.1 | BrnA antitoxin family protein | Antitoxin |
M9O80_RS22970 (M9O80_22970) | 4731146..4731433 | - | 288 | WP_012542979.1 | BrnT family toxin | Toxin |
M9O80_RS22975 (M9O80_22975) | 4731601..4732020 | - | 420 | WP_023297004.1 | FosA5 family fosfomycin resistance glutathione transferase | - |
M9O80_RS22980 (M9O80_22980) | 4732014..4732922 | - | 909 | WP_016160219.1 | LysR family transcriptional regulator | - |
M9O80_RS22985 (M9O80_22985) | 4733009..4733791 | + | 783 | WP_012542981.1 | NAD(P)H-dependent oxidoreductase | - |
M9O80_RS22990 (M9O80_22990) | 4733933..4734517 | + | 585 | WP_004182816.1 | TetR/AcrR family transcriptional regulator | - |
M9O80_RS22995 (M9O80_22995) | 4734539..4735342 | + | 804 | WP_048267404.1 | winged helix-turn-helix domain-containing protein | - |
M9O80_RS23000 (M9O80_23000) | 4735339..4735857 | + | 519 | WP_023297001.1 | FidL-like protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11245.77 Da Isoelectric Point: 8.6574
>T246273 WP_012542979.1 NZ_CP097808:c4731433-4731146 [Klebsiella variicola]
MPMEFEWDANKALSNLRKHGVRFEEAVLVFDDPRHLSRQERFENGEYRWQTIGLVHGILVILVAHSVRFESGTEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKALSNLRKHGVRFEEAVLVFDDPRHLSRQERFENGEYRWQTIGLVHGILVILVAHSVRFESGTEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|