Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4149467..4150086 Replicon chromosome
Accession NZ_CP097808
Organism Klebsiella variicola strain 17YN56

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M9O80_RS20170 Protein ID WP_002892050.1
Coordinates 4149868..4150086 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A1F2MBN7
Locus tag M9O80_RS20165 Protein ID WP_008805436.1
Coordinates 4149467..4149841 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O80_RS20155 (M9O80_20155) 4144622..4145815 + 1194 WP_117119480.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M9O80_RS20160 (M9O80_20160) 4145838..4148984 + 3147 WP_008805437.1 multidrug efflux RND transporter permease subunit AcrB -
M9O80_RS20165 (M9O80_20165) 4149467..4149841 + 375 WP_008805436.1 Hha toxicity modulator TomB Antitoxin
M9O80_RS20170 (M9O80_20170) 4149868..4150086 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M9O80_RS20175 (M9O80_20175) 4150244..4150810 + 567 WP_088717832.1 maltose O-acetyltransferase -
M9O80_RS20180 (M9O80_20180) 4150782..4150913 - 132 Protein_3963 hypothetical protein -
M9O80_RS20185 (M9O80_20185) 4150947..4151417 + 471 WP_008805434.1 YlaC family protein -
M9O80_RS20190 (M9O80_20190) 4151386..4152843 - 1458 WP_117115360.1 PLP-dependent aminotransferase family protein -
M9O80_RS20195 (M9O80_20195) 4152944..4153642 + 699 WP_016160391.1 GNAT family protein -
M9O80_RS20200 (M9O80_20200) 4153639..4153779 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M9O80_RS20205 (M9O80_20205) 4153779..4154042 - 264 WP_008805431.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T246272 WP_002892050.1 NZ_CP097808:4149868-4150086 [Klebsiella variicola]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14384.06 Da        Isoelectric Point: 4.8989

>AT246272 WP_008805436.1 NZ_CP097808:4149467-4149841 [Klebsiella variicola]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYTEDNKLVAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A1F2MBN7

References