Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4149467..4150086 | Replicon | chromosome |
| Accession | NZ_CP097808 | ||
| Organism | Klebsiella variicola strain 17YN56 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | M9O80_RS20170 | Protein ID | WP_002892050.1 |
| Coordinates | 4149868..4150086 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A1F2MBN7 |
| Locus tag | M9O80_RS20165 | Protein ID | WP_008805436.1 |
| Coordinates | 4149467..4149841 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O80_RS20155 (M9O80_20155) | 4144622..4145815 | + | 1194 | WP_117119480.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| M9O80_RS20160 (M9O80_20160) | 4145838..4148984 | + | 3147 | WP_008805437.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| M9O80_RS20165 (M9O80_20165) | 4149467..4149841 | + | 375 | WP_008805436.1 | Hha toxicity modulator TomB | Antitoxin |
| M9O80_RS20170 (M9O80_20170) | 4149868..4150086 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| M9O80_RS20175 (M9O80_20175) | 4150244..4150810 | + | 567 | WP_088717832.1 | maltose O-acetyltransferase | - |
| M9O80_RS20180 (M9O80_20180) | 4150782..4150913 | - | 132 | Protein_3963 | hypothetical protein | - |
| M9O80_RS20185 (M9O80_20185) | 4150947..4151417 | + | 471 | WP_008805434.1 | YlaC family protein | - |
| M9O80_RS20190 (M9O80_20190) | 4151386..4152843 | - | 1458 | WP_117115360.1 | PLP-dependent aminotransferase family protein | - |
| M9O80_RS20195 (M9O80_20195) | 4152944..4153642 | + | 699 | WP_016160391.1 | GNAT family protein | - |
| M9O80_RS20200 (M9O80_20200) | 4153639..4153779 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| M9O80_RS20205 (M9O80_20205) | 4153779..4154042 | - | 264 | WP_008805431.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T246272 WP_002892050.1 NZ_CP097808:4149868-4150086 [Klebsiella variicola]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14384.06 Da Isoelectric Point: 4.8989
>AT246272 WP_008805436.1 NZ_CP097808:4149467-4149841 [Klebsiella variicola]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYTEDNKLVAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYTEDNKLVAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1F2MBN7 |