Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 1778475..1779065 | Replicon | chromosome |
Accession | NZ_CP097808 | ||
Organism | Klebsiella variicola strain 17YN56 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A1F2LYA2 |
Locus tag | M9O80_RS08515 | Protein ID | WP_008804165.1 |
Coordinates | 1778733..1779065 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A1F2LZQ3 |
Locus tag | M9O80_RS08510 | Protein ID | WP_012541132.1 |
Coordinates | 1778475..1778732 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O80_RS08490 (M9O80_08490) | 1774085..1774660 | + | 576 | WP_048271884.1 | hypothetical protein | - |
M9O80_RS08495 (M9O80_08495) | 1774837..1775673 | + | 837 | WP_048271883.1 | alpha/beta hydrolase | - |
M9O80_RS08500 (M9O80_08500) | 1775880..1776851 | + | 972 | WP_048271882.1 | sensor domain-containing diguanylate cyclase | - |
M9O80_RS08505 (M9O80_08505) | 1776848..1777948 | - | 1101 | WP_048271881.1 | AarF/UbiB family protein | - |
M9O80_RS08510 (M9O80_08510) | 1778475..1778732 | + | 258 | WP_012541132.1 | antitoxin | Antitoxin |
M9O80_RS08515 (M9O80_08515) | 1778733..1779065 | + | 333 | WP_008804165.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
M9O80_RS08525 (M9O80_08525) | 1779388..1780824 | + | 1437 | WP_016161429.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
M9O80_RS08535 (M9O80_08535) | 1781197..1782651 | - | 1455 | WP_064141536.1 | AMP nucleosidase | - |
M9O80_RS08540 (M9O80_08540) | 1782782..1783027 | - | 246 | WP_008804171.1 | signal transduction protein PmrD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11867.71 Da Isoelectric Point: 10.1839
>T246265 WP_008804165.1 NZ_CP097808:1778733-1779065 [Klebsiella variicola]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARNGKRLERIPDAVVNEVLARLDAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARNGKRLERIPDAVVNEVLARLDAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1F2LYA2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1F2LZQ3 |