Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 793832..794489 | Replicon | chromosome |
| Accession | NZ_CP097808 | ||
| Organism | Klebsiella variicola strain 17YN56 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | W8UCT0 |
| Locus tag | M9O80_RS03920 | Protein ID | WP_002916310.1 |
| Coordinates | 794079..794489 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | M9O80_RS03915 | Protein ID | WP_002916312.1 |
| Coordinates | 793832..794098 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O80_RS03895 (M9O80_03895) | 790275..791003 | - | 729 | WP_012967245.1 | MurR/RpiR family transcriptional regulator | - |
| M9O80_RS03900 (M9O80_03900) | 791054..791365 | + | 312 | WP_008806430.1 | N(4)-acetylcytidine aminohydrolase | - |
| M9O80_RS03905 (M9O80_03905) | 791528..792187 | + | 660 | WP_008806429.1 | hemolysin III family protein | - |
| M9O80_RS03910 (M9O80_03910) | 792603..793586 | - | 984 | WP_171356132.1 | tRNA-modifying protein YgfZ | - |
| M9O80_RS03915 (M9O80_03915) | 793832..794098 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| M9O80_RS03920 (M9O80_03920) | 794079..794489 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
| M9O80_RS03925 (M9O80_03925) | 794496..795017 | - | 522 | WP_008806427.1 | flavodoxin FldB | - |
| M9O80_RS03930 (M9O80_03930) | 795118..796014 | + | 897 | WP_008806426.1 | site-specific tyrosine recombinase XerD | - |
| M9O80_RS03935 (M9O80_03935) | 796037..796750 | + | 714 | WP_008806425.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M9O80_RS03940 (M9O80_03940) | 796756..798489 | + | 1734 | WP_117115731.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T246263 WP_002916310.1 NZ_CP097808:794079-794489 [Klebsiella variicola]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GSW7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |