Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 325853..326439 | Replicon | chromosome |
| Accession | NZ_CP097808 | ||
| Organism | Klebsiella variicola strain 17YN56 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A2W7TCK5 |
| Locus tag | M9O80_RS01500 | Protein ID | WP_008806973.1 |
| Coordinates | 326071..326439 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | W9B1V1 |
| Locus tag | M9O80_RS01495 | Protein ID | WP_004174006.1 |
| Coordinates | 325853..326074 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O80_RS01475 (M9O80_01475) | 322010..322936 | + | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| M9O80_RS01480 (M9O80_01480) | 322933..324210 | + | 1278 | WP_117115546.1 | branched chain amino acid ABC transporter permease LivM | - |
| M9O80_RS01485 (M9O80_01485) | 324207..324974 | + | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| M9O80_RS01490 (M9O80_01490) | 324976..325689 | + | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| M9O80_RS01495 (M9O80_01495) | 325853..326074 | + | 222 | WP_004174006.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| M9O80_RS01500 (M9O80_01500) | 326071..326439 | + | 369 | WP_008806973.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| M9O80_RS01505 (M9O80_01505) | 326731..328047 | + | 1317 | WP_008806974.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| M9O80_RS01510 (M9O80_01510) | 328149..329036 | + | 888 | WP_012967120.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| M9O80_RS01515 (M9O80_01515) | 329033..329878 | + | 846 | WP_008806976.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| M9O80_RS01520 (M9O80_01520) | 329880..330950 | + | 1071 | WP_023323353.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 315744..331687 | 15943 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13639.01 Da Isoelectric Point: 7.3191
>T246262 WP_008806973.1 NZ_CP097808:326071-326439 [Klebsiella variicola]
MTLQIISAEEIIQFHDRLLRVTPDVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLVISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPDVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLVISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2W7TCK5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5E5YJY7 |