Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 325853..326439 Replicon chromosome
Accession NZ_CP097808
Organism Klebsiella variicola strain 17YN56

Toxin (Protein)


Gene name doc Uniprot ID A0A2W7TCK5
Locus tag M9O80_RS01500 Protein ID WP_008806973.1
Coordinates 326071..326439 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag M9O80_RS01495 Protein ID WP_004174006.1
Coordinates 325853..326074 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O80_RS01475 (M9O80_01475) 322010..322936 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
M9O80_RS01480 (M9O80_01480) 322933..324210 + 1278 WP_117115546.1 branched chain amino acid ABC transporter permease LivM -
M9O80_RS01485 (M9O80_01485) 324207..324974 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
M9O80_RS01490 (M9O80_01490) 324976..325689 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
M9O80_RS01495 (M9O80_01495) 325853..326074 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M9O80_RS01500 (M9O80_01500) 326071..326439 + 369 WP_008806973.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M9O80_RS01505 (M9O80_01505) 326731..328047 + 1317 WP_008806974.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
M9O80_RS01510 (M9O80_01510) 328149..329036 + 888 WP_012967120.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
M9O80_RS01515 (M9O80_01515) 329033..329878 + 846 WP_008806976.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
M9O80_RS01520 (M9O80_01520) 329880..330950 + 1071 WP_023323353.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 315744..331687 15943


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(6-116)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13639.01 Da        Isoelectric Point: 7.3191

>T246262 WP_008806973.1 NZ_CP097808:326071-326439 [Klebsiella variicola]
MTLQIISAEEIIQFHDRLLRVTPDVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLVISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT246262 WP_004174006.1 NZ_CP097808:325853-326074 [Klebsiella variicola]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2W7TCK5

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References