Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1293298..1293902 Replicon chromosome
Accession NZ_CP097807
Organism Thalassospira sp. GO-4

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag M9H61_RS06190 Protein ID WP_250283986.1
Coordinates 1293298..1293486 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name hicA Uniprot ID -
Locus tag M9H61_RS06195 Protein ID WP_250283988.1
Coordinates 1293534..1293902 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9H61_RS06165 (M9H61_06165) 1288626..1289663 - 1038 WP_068518516.1 C4-dicarboxylate TRAP transporter substrate-binding protein -
M9H61_RS06170 (M9H61_06170) 1289808..1290425 - 618 WP_231856719.1 LysR substrate-binding domain-containing protein -
M9H61_RS06175 (M9H61_06175) 1290531..1290731 - 201 Protein_1200 LysR family transcriptional regulator -
M9H61_RS06180 (M9H61_06180) 1291032..1291940 + 909 WP_250283982.1 EamA family transporter -
M9H61_RS06185 (M9H61_06185) 1292085..1293221 + 1137 WP_250283984.1 DMT family transporter -
M9H61_RS06190 (M9H61_06190) 1293298..1293486 + 189 WP_250283986.1 type II toxin-antitoxin system HicA family toxin Toxin
M9H61_RS06195 (M9H61_06195) 1293534..1293902 + 369 WP_250283988.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
M9H61_RS06200 (M9H61_06200) 1294104..1294787 - 684 WP_250283990.1 hypothetical protein -
M9H61_RS06205 (M9H61_06205) 1295209..1296012 - 804 WP_250283992.1 trypsin-like peptidase domain-containing protein -
M9H61_RS06215 (M9H61_06215) 1296508..1297653 - 1146 WP_068518521.1 tRNA 2-thiouridine(34) synthase MnmA -
M9H61_RS06220 (M9H61_06220) 1297771..1298475 - 705 WP_250285031.1 thiaminase II -
M9H61_RS06225 (M9H61_06225) 1298626..1298823 - 198 WP_068518522.1 Fe-S cluster assembly protein IscX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(8-118)


Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7087.27 Da        Isoelectric Point: 11.1981

>T246258 WP_250283986.1 NZ_CP097807:1293298-1293486 [Thalassospira sp. GO-4]
MDSREILKRLKDDGWEIIRTKGSHHQLAHPTKPGRVTVPHPKRDLPKGTVKSIERQSGIKLL

Download         Length: 189 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13087.89 Da        Isoelectric Point: 4.4676

>AT246258 WP_250283988.1 NZ_CP097807:1293534-1293902 [Thalassospira sp. GO-4]
MKQTYWGLVHTDDDGGFGISFPDFPGCVSAADTMTELVELGTEALNFHIEGMHEDGLEIPLPTPSVELSDGAIGIVAITA
TIPGKKRRINLTIDANLIDLIEAKHGKRAVSGFLEEAARRAL

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References