Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 405396..406024 | Replicon | chromosome |
| Accession | NZ_CP097807 | ||
| Organism | Thalassospira sp. GO-4 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | M9H61_RS01985 | Protein ID | WP_250283071.1 |
| Coordinates | 405396..405794 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | M9H61_RS01990 | Protein ID | WP_228195922.1 |
| Coordinates | 405794..406024 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9H61_RS01975 (M9H61_01975) | 401415..404222 | - | 2808 | WP_250283067.1 | ribosome-associated ATPase/putative transporter RbbA | - |
| M9H61_RS01980 (M9H61_01980) | 404222..405232 | - | 1011 | WP_250283069.1 | efflux RND transporter periplasmic adaptor subunit | - |
| M9H61_RS01985 (M9H61_01985) | 405396..405794 | - | 399 | WP_250283071.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| M9H61_RS01990 (M9H61_01990) | 405794..406024 | - | 231 | WP_228195922.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| M9H61_RS01995 (M9H61_01995) | 406112..406462 | - | 351 | WP_250283073.1 | Dabb family protein | - |
| M9H61_RS02000 (M9H61_02000) | 406501..407805 | - | 1305 | WP_250283075.1 | aspartate aminotransferase family protein | - |
| M9H61_RS02005 (M9H61_02005) | 407926..408849 | + | 924 | WP_250283077.1 | LysR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14851.00 Da Isoelectric Point: 6.8629
>T246257 WP_250283071.1 NZ_CP097807:c405794-405396 [Thalassospira sp. GO-4]
MLRFMLDTNICIYVIKNRPASCREKFRTHSGAMAISSVTLAELIYGAMKSAKPESNLRTIEEFAARLSVLDFDTDAAGHY
GDIRSTLEREGNVIGPYDMMIAGHARSHGLILVTNNTREFERVDGLRLENWV
MLRFMLDTNICIYVIKNRPASCREKFRTHSGAMAISSVTLAELIYGAMKSAKPESNLRTIEEFAARLSVLDFDTDAAGHY
GDIRSTLEREGNVIGPYDMMIAGHARSHGLILVTNNTREFERVDGLRLENWV
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|