Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pmenTA/darT(toxin) |
Location | 1224140..1224885 | Replicon | chromosome |
Accession | NZ_CP097804 | ||
Organism | Xanthomonas oryzae pv. oryzae strain FY517 |
Toxin (Protein)
Gene name | pmenT | Uniprot ID | - |
Locus tag | M9500_RS05790 | Protein ID | WP_199285672.1 |
Coordinates | 1224140..1224469 (+) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | pmenA | Uniprot ID | - |
Locus tag | M9500_RS05795 | Protein ID | WP_011407754.1 |
Coordinates | 1224466..1224885 (+) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9500_RS05760 (M9500_05760) | 1219271..1219942 | + | 672 | WP_011407759.1 | class I SAM-dependent methyltransferase | - |
M9500_RS05770 (M9500_05770) | 1220244..1221035 | - | 792 | WP_011407758.1 | polysaccharide deacetylase family protein | - |
M9500_RS05775 (M9500_05775) | 1221081..1222007 | + | 927 | WP_011257932.1 | Grx4 family monothiol glutaredoxin | - |
M9500_RS05780 (M9500_05780) | 1222339..1222674 | + | 336 | WP_011407757.1 | DarT ssDNA thymidine ADP-ribosyltransferase family protein | - |
M9500_RS05785 (M9500_05785) | 1222718..1224037 | - | 1320 | WP_109182117.1 | IS701-like element ISXo15 family transposase | - |
M9500_RS05790 (M9500_05790) | 1224140..1224469 | + | 330 | WP_199285672.1 | DUF4433 domain-containing protein | Toxin |
M9500_RS05795 (M9500_05795) | 1224466..1224885 | + | 420 | WP_011407754.1 | macro domain-containing protein | Antitoxin |
M9500_RS05800 (M9500_05800) | 1224937..1225905 | + | 969 | WP_011258802.1 | IS5-like element ISXo1 family transposase | - |
M9500_RS05805 (M9500_05805) | 1226016..1226696 | + | 681 | WP_011257926.1 | phosphate phosphatase | - |
M9500_RS05810 (M9500_05810) | 1226734..1227969 | - | 1236 | WP_250277150.1 | ISL3-like element ISXoo13 family transposase | - |
M9500_RS05815 (M9500_05815) | 1228271..1228597 | + | 327 | Protein_1114 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 1222718..1227969 | 5251 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 13145.86 Da Isoelectric Point: 7.1160
>T246252 WP_199285672.1 NZ_CP097804:1224140-1224469 [Xanthomonas oryzae pv. oryzae]
MHHVAERRWPFLFTDSHAYCQLASFYSDLSDLDKIDWPLLQARDFRRDPDDPAKFERYQAEALIHRHLPLDGLRGIVCHT
DGLKQTIERQLQERNLKLPVHTRTDWYFR
MHHVAERRWPFLFTDSHAYCQLASFYSDLSDLDKIDWPLLQARDFRRDPDDPAKFERYQAEALIHRHLPLDGLRGIVCHT
DGLKQTIERQLQERNLKLPVHTRTDWYFR
Download Length: 330 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15607.02 Da Isoelectric Point: 6.4733
>AT246252 WP_011407754.1 NZ_CP097804:1224466-1224885 [Xanthomonas oryzae pv. oryzae]
MITFTQGNLLESGAEALVNTVNTVGVMGKGIALMFKERFKENFLRYAAACKDNQVRIGKIFVTEVNELDGPRWIINFPTK
QHWRGDSRIEWITEGLQDLHRFLIENKVKSIAIPPLGAGNGGLDWAEVRPLIEEVLGNL
MITFTQGNLLESGAEALVNTVNTVGVMGKGIALMFKERFKENFLRYAAACKDNQVRIGKIFVTEVNELDGPRWIINFPTK
QHWRGDSRIEWITEGLQDLHRFLIENKVKSIAIPPLGAGNGGLDWAEVRPLIEEVLGNL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|