Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1139260..1139905 Replicon chromosome
Accession NZ_CP097799
Organism Pasteurella multocida strain 39639

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag M9410_RS05305 Protein ID WP_016533497.1
Coordinates 1139723..1139905 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A8E2AAC1
Locus tag M9410_RS05300 Protein ID WP_005756614.1
Coordinates 1139260..1139694 (-) Length 145 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9410_RS05265 (M9410_05265) 1134846..1135421 + 576 WP_005756625.1 hypothetical protein -
M9410_RS05270 (M9410_05270) 1135897..1136514 + 618 WP_032854013.1 KilA-N domain-containing protein -
M9410_RS05275 (M9410_05275) 1136782..1137117 + 336 WP_005756621.1 hypothetical protein -
M9410_RS05280 (M9410_05280) 1137128..1137679 + 552 WP_005756619.1 hypothetical protein -
M9410_RS05285 (M9410_05285) 1137794..1138159 + 366 WP_250250798.1 phage holin, lambda family -
M9410_RS05290 (M9410_05290) 1138131..1138715 + 585 WP_005756617.1 glycoside hydrolase family 19 protein -
M9410_RS05295 (M9410_05295) 1138718..1139041 + 324 WP_005756616.1 DUF2570 family protein -
M9410_RS05300 (M9410_05300) 1139260..1139694 - 435 WP_005756614.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
M9410_RS05305 (M9410_05305) 1139723..1139905 - 183 WP_016533497.1 type II toxin-antitoxin system HicA family toxin Toxin
M9410_RS05310 (M9410_05310) 1139988..1140524 + 537 WP_005756612.1 terminase small subunit -
M9410_RS05315 (M9410_05315) 1140508..1141740 + 1233 WP_005756610.1 PBSX family phage terminase large subunit -
M9410_RS05320 (M9410_05320) 1141750..1143153 + 1404 WP_005756608.1 DUF4055 domain-containing protein -
M9410_RS05325 (M9410_05325) 1143131..1144744 + 1614 WP_231104088.1 minor capsid protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1110044..1171044 61000


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(5-134)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6605.77 Da        Isoelectric Point: 10.4152

>T246250 WP_016533497.1 NZ_CP097799:c1139905-1139723 [Pasteurella multocida]
VNSHDLIKELTAIGCTELRCKGSHHIWYSPKTGKTFPVPHPKKDLPIGTVRSIKKSAGLL

Download         Length: 183 bp

Antitoxin


Download         Length: 145 a.a.        Molecular weight: 16603.84 Da        Isoelectric Point: 4.2518

>AT246250 WP_005756614.1 NZ_CP097799:c1139694-1139260 [Pasteurella multocida]
MLFTIGVETPKNENEAFGLCVPALFNETYSCFSAADTVEEIIPTVTDAIYTILEIMVEDNFDISQIKDLGFMHYKQQKDF
EFCDSWLLIDVDITAYFGKRQRVNVVLPQYLIDRIDQRVANNPTYKDRSHFLTIASQRELSSSL

Download         Length: 435 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References