Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1139260..1139905 | Replicon | chromosome |
| Accession | NZ_CP097799 | ||
| Organism | Pasteurella multocida strain 39639 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | M9410_RS05305 | Protein ID | WP_016533497.1 |
| Coordinates | 1139723..1139905 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A8E2AAC1 |
| Locus tag | M9410_RS05300 | Protein ID | WP_005756614.1 |
| Coordinates | 1139260..1139694 (-) | Length | 145 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9410_RS05265 (M9410_05265) | 1134846..1135421 | + | 576 | WP_005756625.1 | hypothetical protein | - |
| M9410_RS05270 (M9410_05270) | 1135897..1136514 | + | 618 | WP_032854013.1 | KilA-N domain-containing protein | - |
| M9410_RS05275 (M9410_05275) | 1136782..1137117 | + | 336 | WP_005756621.1 | hypothetical protein | - |
| M9410_RS05280 (M9410_05280) | 1137128..1137679 | + | 552 | WP_005756619.1 | hypothetical protein | - |
| M9410_RS05285 (M9410_05285) | 1137794..1138159 | + | 366 | WP_250250798.1 | phage holin, lambda family | - |
| M9410_RS05290 (M9410_05290) | 1138131..1138715 | + | 585 | WP_005756617.1 | glycoside hydrolase family 19 protein | - |
| M9410_RS05295 (M9410_05295) | 1138718..1139041 | + | 324 | WP_005756616.1 | DUF2570 family protein | - |
| M9410_RS05300 (M9410_05300) | 1139260..1139694 | - | 435 | WP_005756614.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| M9410_RS05305 (M9410_05305) | 1139723..1139905 | - | 183 | WP_016533497.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| M9410_RS05310 (M9410_05310) | 1139988..1140524 | + | 537 | WP_005756612.1 | terminase small subunit | - |
| M9410_RS05315 (M9410_05315) | 1140508..1141740 | + | 1233 | WP_005756610.1 | PBSX family phage terminase large subunit | - |
| M9410_RS05320 (M9410_05320) | 1141750..1143153 | + | 1404 | WP_005756608.1 | DUF4055 domain-containing protein | - |
| M9410_RS05325 (M9410_05325) | 1143131..1144744 | + | 1614 | WP_231104088.1 | minor capsid protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1110044..1171044 | 61000 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6605.77 Da Isoelectric Point: 10.4152
>T246250 WP_016533497.1 NZ_CP097799:c1139905-1139723 [Pasteurella multocida]
VNSHDLIKELTAIGCTELRCKGSHHIWYSPKTGKTFPVPHPKKDLPIGTVRSIKKSAGLL
VNSHDLIKELTAIGCTELRCKGSHHIWYSPKTGKTFPVPHPKKDLPIGTVRSIKKSAGLL
Download Length: 183 bp
Antitoxin
Download Length: 145 a.a. Molecular weight: 16603.84 Da Isoelectric Point: 4.2518
>AT246250 WP_005756614.1 NZ_CP097799:c1139694-1139260 [Pasteurella multocida]
MLFTIGVETPKNENEAFGLCVPALFNETYSCFSAADTVEEIIPTVTDAIYTILEIMVEDNFDISQIKDLGFMHYKQQKDF
EFCDSWLLIDVDITAYFGKRQRVNVVLPQYLIDRIDQRVANNPTYKDRSHFLTIASQRELSSSL
MLFTIGVETPKNENEAFGLCVPALFNETYSCFSAADTVEEIIPTVTDAIYTILEIMVEDNFDISQIKDLGFMHYKQQKDF
EFCDSWLLIDVDITAYFGKRQRVNVVLPQYLIDRIDQRVANNPTYKDRSHFLTIASQRELSSSL
Download Length: 435 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|