Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-PumB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 1125369..1125970 | Replicon | chromosome |
| Accession | NZ_CP097799 | ||
| Organism | Pasteurella multocida strain 39639 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A8E2DA97 |
| Locus tag | M9410_RS05185 | Protein ID | WP_005756650.1 |
| Coordinates | 1125369..1125683 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | M9410_RS05190 | Protein ID | WP_005756647.1 |
| Coordinates | 1125680..1125970 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9410_RS05155 (M9410_05155) | 1120995..1122251 | - | 1257 | WP_032854019.1 | hypothetical protein | - |
| M9410_RS05160 (M9410_05160) | 1122334..1123131 | - | 798 | WP_032854018.1 | hypothetical protein | - |
| M9410_RS05165 (M9410_05165) | 1123249..1123713 | - | 465 | WP_169319013.1 | DUF4760 domain-containing protein | - |
| M9410_RS05170 (M9410_05170) | 1124199..1124426 | - | 228 | WP_032854017.1 | hypothetical protein | - |
| M9410_RS05175 (M9410_05175) | 1124669..1124878 | - | 210 | WP_005756656.1 | hypothetical protein | - |
| M9410_RS05180 (M9410_05180) | 1124891..1125058 | + | 168 | WP_005756653.1 | DUF1508 domain-containing protein | - |
| M9410_RS05185 (M9410_05185) | 1125369..1125683 | + | 315 | WP_005756650.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M9410_RS05190 (M9410_05190) | 1125680..1125970 | + | 291 | WP_005756647.1 | putative addiction module antidote protein | Antitoxin |
| M9410_RS05195 (M9410_05195) | 1125994..1126701 | - | 708 | WP_005756645.1 | MAE_28990/MAE_18760 family HEPN-like nuclease | - |
| M9410_RS05200 (M9410_05200) | 1126698..1127765 | - | 1068 | WP_005756643.1 | DUF262 domain-containing protein | - |
| M9410_RS05205 (M9410_05205) | 1127809..1128498 | - | 690 | WP_005756642.1 | helix-turn-helix transcriptional regulator | - |
| M9410_RS05210 (M9410_05210) | 1128626..1128835 | + | 210 | WP_005720263.1 | helix-turn-helix transcriptional regulator | - |
| M9410_RS05215 (M9410_05215) | 1128856..1129131 | + | 276 | WP_005756640.1 | hypothetical protein | - |
| M9410_RS05220 (M9410_05220) | 1129134..1129541 | - | 408 | WP_032854015.1 | hypothetical protein | - |
| M9410_RS05225 (M9410_05225) | 1129648..1129893 | + | 246 | WP_005725517.1 | helix-turn-helix domain-containing protein | - |
| M9410_RS05230 (M9410_05230) | 1129971..1130789 | + | 819 | WP_005756636.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1110044..1171044 | 61000 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11749.63 Da Isoelectric Point: 9.5553
>T246249 WP_005756650.1 NZ_CP097799:1125369-1125683 [Pasteurella multocida]
MLDVIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEELNV
MLDVIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEELNV
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|