Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-PumB/upstrm_HI1419-dnstrm_HI1420
Location 1125369..1125970 Replicon chromosome
Accession NZ_CP097799
Organism Pasteurella multocida strain 39639

Toxin (Protein)


Gene name relE Uniprot ID A0A8E2DA97
Locus tag M9410_RS05185 Protein ID WP_005756650.1
Coordinates 1125369..1125683 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name PumB Uniprot ID -
Locus tag M9410_RS05190 Protein ID WP_005756647.1
Coordinates 1125680..1125970 (+) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9410_RS05155 (M9410_05155) 1120995..1122251 - 1257 WP_032854019.1 hypothetical protein -
M9410_RS05160 (M9410_05160) 1122334..1123131 - 798 WP_032854018.1 hypothetical protein -
M9410_RS05165 (M9410_05165) 1123249..1123713 - 465 WP_169319013.1 DUF4760 domain-containing protein -
M9410_RS05170 (M9410_05170) 1124199..1124426 - 228 WP_032854017.1 hypothetical protein -
M9410_RS05175 (M9410_05175) 1124669..1124878 - 210 WP_005756656.1 hypothetical protein -
M9410_RS05180 (M9410_05180) 1124891..1125058 + 168 WP_005756653.1 DUF1508 domain-containing protein -
M9410_RS05185 (M9410_05185) 1125369..1125683 + 315 WP_005756650.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M9410_RS05190 (M9410_05190) 1125680..1125970 + 291 WP_005756647.1 putative addiction module antidote protein Antitoxin
M9410_RS05195 (M9410_05195) 1125994..1126701 - 708 WP_005756645.1 MAE_28990/MAE_18760 family HEPN-like nuclease -
M9410_RS05200 (M9410_05200) 1126698..1127765 - 1068 WP_005756643.1 DUF262 domain-containing protein -
M9410_RS05205 (M9410_05205) 1127809..1128498 - 690 WP_005756642.1 helix-turn-helix transcriptional regulator -
M9410_RS05210 (M9410_05210) 1128626..1128835 + 210 WP_005720263.1 helix-turn-helix transcriptional regulator -
M9410_RS05215 (M9410_05215) 1128856..1129131 + 276 WP_005756640.1 hypothetical protein -
M9410_RS05220 (M9410_05220) 1129134..1129541 - 408 WP_032854015.1 hypothetical protein -
M9410_RS05225 (M9410_05225) 1129648..1129893 + 246 WP_005725517.1 helix-turn-helix domain-containing protein -
M9410_RS05230 (M9410_05230) 1129971..1130789 + 819 WP_005756636.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1110044..1171044 61000


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(4-95)

Antitoxin

Cro/C1-type helix-turn-helix domain

(47-91)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11749.63 Da        Isoelectric Point: 9.5553

>T246249 WP_005756650.1 NZ_CP097799:1125369-1125683 [Pasteurella multocida]
MLDVIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEELNV

Download         Length: 315 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10564.25 Da        Isoelectric Point: 6.2258

>AT246249 WP_005756647.1 NZ_CP097799:1125680-1125970 [Pasteurella multocida]
MSKKVELKPFDIAEHLDSEEMIAAYLSEVLETGDTNEFISALGDVARARGMTELAAKTGLGRESLYKTLSHGSKPRFDTI
MKITQALGIKLVPMHI

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References