Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 699096..699670 | Replicon | chromosome |
| Accession | NZ_CP097798 | ||
| Organism | Pasteurella multocida strain 29792 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | A0A849CFF7 |
| Locus tag | M9416_RS03475 | Protein ID | WP_014667974.1 |
| Coordinates | 699096..699380 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | A0A849CG04 |
| Locus tag | M9416_RS03480 | Protein ID | WP_014391174.1 |
| Coordinates | 699377..699670 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9416_RS03455 (M9416_03455) | 694558..696744 | + | 2187 | WP_014667973.1 | S8 family peptidase | - |
| M9416_RS03460 (M9416_03460) | 697044..697229 | + | 186 | WP_016534551.1 | hypothetical protein | - |
| M9416_RS03465 (M9416_03465) | 697541..697802 | + | 262 | Protein_663 | hypothetical protein | - |
| M9416_RS03475 (M9416_03475) | 699096..699380 | + | 285 | WP_014667974.1 | addiction module protein | Toxin |
| M9416_RS03480 (M9416_03480) | 699377..699670 | + | 294 | WP_014391174.1 | putative addiction module antidote protein | Antitoxin |
| M9416_RS03485 (M9416_03485) | 700068..700745 | - | 678 | WP_014667975.1 | 3-keto-L-gulonate-6-phosphate decarboxylase UlaD | - |
| M9416_RS03490 (M9416_03490) | 700763..701230 | - | 468 | WP_014391172.1 | PTS sugar transporter subunit IIA | - |
| M9416_RS03495 (M9416_03495) | 701275..703065 | - | 1791 | WP_014667976.1 | PTS ascorbate-specific subunit IIBC | - |
| M9416_RS03500 (M9416_03500) | 703414..704505 | + | 1092 | WP_005756839.1 | L-ascorbate 6-phosphate lactonase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 697641..697802 | 161 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10702.41 Da Isoelectric Point: 10.2849
>T246247 WP_014667974.1 NZ_CP097798:699096-699380 [Pasteurella multocida]
VGRLREVKNLSAKAAVLARINRVMNGNLGDHKSIGNGLYEMRIIKGSGYRVYYGQYREVTYLLICGGDKSTQKSDIVKAR
ELWKEIKQQEEVKV
VGRLREVKNLSAKAAVLARINRVMNGNLGDHKSIGNGLYEMRIIKGSGYRVYYGQYREVTYLLICGGDKSTQKSDIVKAR
ELWKEIKQQEEVKV
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A849CFF7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A849CG04 |