Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 1673810..1674407 | Replicon | chromosome |
| Accession | NZ_CP097797 | ||
| Organism | Pasteurella multocida strain 29135 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | M9418_RS07870 | Protein ID | WP_078802155.1 |
| Coordinates | 1673810..1674109 (+) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | M9418_RS07875 | Protein ID | WP_078802156.1 |
| Coordinates | 1674111..1674407 (+) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9418_RS07825 (M9418_07825) | 1669003..1669239 | - | 237 | WP_116538882.1 | hypothetical protein | - |
| M9418_RS07830 (M9418_07830) | 1669211..1669510 | - | 300 | WP_116538883.1 | hypothetical protein | - |
| M9418_RS07835 (M9418_07835) | 1669658..1669888 | + | 231 | WP_223251317.1 | hypothetical protein | - |
| M9418_RS07840 (M9418_07840) | 1669950..1670591 | - | 642 | WP_170376553.1 | Bro-N domain-containing protein | - |
| M9418_RS07845 (M9418_07845) | 1670846..1671109 | - | 264 | WP_071522857.1 | hypothetical protein | - |
| M9418_RS07850 (M9418_07850) | 1671293..1671565 | + | 273 | WP_014391457.1 | hypothetical protein | - |
| M9418_RS07855 (M9418_07855) | 1671558..1671746 | - | 189 | WP_014391458.1 | hypothetical protein | - |
| M9418_RS07865 (M9418_07865) | 1673332..1673529 | - | 198 | WP_250274084.1 | hypothetical protein | - |
| M9418_RS07870 (M9418_07870) | 1673810..1674109 | + | 300 | WP_078802155.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M9418_RS07875 (M9418_07875) | 1674111..1674407 | + | 297 | WP_078802156.1 | putative addiction module antidote protein | Antitoxin |
| M9418_RS07880 (M9418_07880) | 1674501..1675157 | - | 657 | WP_250274085.1 | XRE family transcriptional regulator | - |
| M9418_RS07885 (M9418_07885) | 1675288..1675494 | + | 207 | WP_250274086.1 | helix-turn-helix transcriptional regulator | - |
| M9418_RS07890 (M9418_07890) | 1675544..1675996 | + | 453 | WP_250274087.1 | hypothetical protein | - |
| M9418_RS07895 (M9418_07895) | 1676048..1676731 | + | 684 | Protein_1532 | phage antirepressor KilAC domain-containing protein | - |
| M9418_RS07900 (M9418_07900) | 1676728..1677081 | + | 354 | WP_014390722.1 | HNH endonuclease signature motif containing protein | - |
| M9418_RS07905 (M9418_07905) | 1677083..1677982 | + | 900 | WP_014390723.1 | hypothetical protein | - |
| M9418_RS07910 (M9418_07910) | 1677982..1678677 | + | 696 | WP_170376580.1 | replication protein P | - |
| M9418_RS07915 (M9418_07915) | 1678670..1679200 | + | 531 | WP_170356878.1 | MT-A70 family methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1660259..1711949 | 51690 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11415.35 Da Isoelectric Point: 10.6963
>T246246 WP_078802155.1 NZ_CP097797:1673810-1674109 [Pasteurella multocida]
MTIRIKTTERFDSWLRKLKNPRAKMKINARIKRLQFGNFGDLKTVNDGIFEMRIDEGQGYRIYLKNNNSVVVILLCGGDK
STQNKDIKLAKQIAEELGV
MTIRIKTTERFDSWLRKLKNPRAKMKINARIKRLQFGNFGDLKTVNDGIFEMRIDEGQGYRIYLKNNNSVVVILLCGGDK
STQNKDIKLAKQIAEELGV
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|