Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/upstrm_HI1419-dnstrm_HI1420
Location 1673810..1674407 Replicon chromosome
Accession NZ_CP097797
Organism Pasteurella multocida strain 29135

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag M9418_RS07870 Protein ID WP_078802155.1
Coordinates 1673810..1674109 (+) Length 100 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag M9418_RS07875 Protein ID WP_078802156.1
Coordinates 1674111..1674407 (+) Length 99 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9418_RS07825 (M9418_07825) 1669003..1669239 - 237 WP_116538882.1 hypothetical protein -
M9418_RS07830 (M9418_07830) 1669211..1669510 - 300 WP_116538883.1 hypothetical protein -
M9418_RS07835 (M9418_07835) 1669658..1669888 + 231 WP_223251317.1 hypothetical protein -
M9418_RS07840 (M9418_07840) 1669950..1670591 - 642 WP_170376553.1 Bro-N domain-containing protein -
M9418_RS07845 (M9418_07845) 1670846..1671109 - 264 WP_071522857.1 hypothetical protein -
M9418_RS07850 (M9418_07850) 1671293..1671565 + 273 WP_014391457.1 hypothetical protein -
M9418_RS07855 (M9418_07855) 1671558..1671746 - 189 WP_014391458.1 hypothetical protein -
M9418_RS07865 (M9418_07865) 1673332..1673529 - 198 WP_250274084.1 hypothetical protein -
M9418_RS07870 (M9418_07870) 1673810..1674109 + 300 WP_078802155.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M9418_RS07875 (M9418_07875) 1674111..1674407 + 297 WP_078802156.1 putative addiction module antidote protein Antitoxin
M9418_RS07880 (M9418_07880) 1674501..1675157 - 657 WP_250274085.1 XRE family transcriptional regulator -
M9418_RS07885 (M9418_07885) 1675288..1675494 + 207 WP_250274086.1 helix-turn-helix transcriptional regulator -
M9418_RS07890 (M9418_07890) 1675544..1675996 + 453 WP_250274087.1 hypothetical protein -
M9418_RS07895 (M9418_07895) 1676048..1676731 + 684 Protein_1532 phage antirepressor KilAC domain-containing protein -
M9418_RS07900 (M9418_07900) 1676728..1677081 + 354 WP_014390722.1 HNH endonuclease signature motif containing protein -
M9418_RS07905 (M9418_07905) 1677083..1677982 + 900 WP_014390723.1 hypothetical protein -
M9418_RS07910 (M9418_07910) 1677982..1678677 + 696 WP_170376580.1 replication protein P -
M9418_RS07915 (M9418_07915) 1678670..1679200 + 531 WP_170356878.1 MT-A70 family methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1660259..1711949 51690


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-98)

Antitoxin

Uncharacterized protein HI1420

(4-90)


Sequences

Toxin        


Download         Length: 100 a.a.        Molecular weight: 11415.35 Da        Isoelectric Point: 10.6963

>T246246 WP_078802155.1 NZ_CP097797:1673810-1674109 [Pasteurella multocida]
MTIRIKTTERFDSWLRKLKNPRAKMKINARIKRLQFGNFGDLKTVNDGIFEMRIDEGQGYRIYLKNNNSVVVILLCGGDK
STQNKDIKLAKQIAEELGV

Download         Length: 300 bp

Antitoxin


Download         Length: 99 a.a.        Molecular weight: 11054.67 Da        Isoelectric Point: 4.8668

>AT246246 WP_078802156.1 NZ_CP097797:1674111-1674407 [Pasteurella multocida]
MEQLKDFDIAEHLTTEEEIRLYLNEILQEDNIELILSALGDIARARNISQISRETGISREGLYKALSGKGNPTFATVLKV
MKALNLQFEVKVNNVIHA

Download         Length: 297 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References